DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pc and Cbx4

Sequence 1:NP_524199.1 Gene:Pc FlyBaseID:FBgn0003042 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_031651.2 Gene:Cbx4 MGIID:1195985 Length:551 Species:Mus musculus

Alignment Length:366 Identity:86/367 (23%)
Similarity:137/367 (37%) Gaps:75/367 (20%)


  Fly    25 VYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYEQTNKSSGTPSKRGIKK 89
            |:|.|.|.:||::||.|||.|||:||:.:|||||||.||||.||:..::...:..   ...|.:|
Mouse    10 VFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQE---QLMGYRK 71

  Fly    90 KEKEPDP----EPESEEDEYTFT-------ENDVDTHQATTSSATHDKESKKEKKHHHHHHHHHH 143
            :..:|.|    .|.........|       :|.......|.......:.....||||.:..|   
Mouse    72 RGPKPKPLVVQVPTFARRSNVLTGLQDSSADNRAKLELGTQGKGQGHQYELNSKKHHQYQPH--- 133

  Fly   144 IKSERNSGRRSESPLTHHHHHHHHESKRQRIDHSSSSNSSFTHNSFVPEP---------DSNSSS 199
              |:..|| :...|.....:::...||:              |:.:.|:|         ....:.
Mouse   134 --SKERSG-KPPPPGKSGKYYYQLNSKK--------------HHPYQPDPKMYDLQYQGGHKEAP 181

  Fly   200 SEDQPLIGTKRK---------------AEVLKESGKIGVTIKTSPDGPT--IKPQPTQQVTPS-- 245
            |...|.:|||..               ..|....|..|...|.|..||.  :.|.|.:.||.:  
Mouse   182 SPTCPDLGTKSHPPDKWAHGAAAKGYLGAVKPLGGGAGAPGKGSEKGPPNGMTPAPKEAVTGNGI 246

  Fly   246 --QQQPFQDQQQAEKIASEAATQLKSEQQATPLATEAINTTPAESGAEEEEVANE---EGNQQAP 305
              :.:..:::.:..:|....:..:::..||..:.:.......|.|.:.::..|.|   :|::...
Mouse   247 GGKMKIVKNKNKNGRIVIVMSKYMENGMQAVKIKSGEAAEGEARSPSHKKRAAEERHPQGDRTFK 311

  Fly   306 QV--PSENNNIPKPCNN-----LAINQKQPLTPLSPRALPP 339
            :.  .||......||..     |.....|| ..|..|.|.|
Mouse   312 KAAGASEEKKAEVPCKRREEEALVSGDAQP-QDLGSRKLSP 351

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PcNP_524199.1 CHROMO 25..77 CDD:214605 29/52 (56%)
Cbx4NP_031651.2 CHROMO 10..62 CDD:214605 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2748
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4654
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T615680
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2447
TreeFam 1 0.960
65.950

Return to query results.
Submit another query.