DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pc and Cbx2

Sequence 1:NP_524199.1 Gene:Pc FlyBaseID:FBgn0003042 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_006532166.1 Gene:Cbx2 MGIID:88289 Length:594 Species:Mus musculus

Alignment Length:172 Identity:44/173 (25%)
Similarity:64/173 (37%) Gaps:53/173 (31%)


  Fly   227 TSPDGPTIKPQPTQQVTPSQQQPFQDQQQAEKIASEAATQLKSEQQATPLATEAINT--TPAESG 289
            :.|.|..:...||            |..:.||:..:|.        |.|..:...:|  :.|.||
Mouse   456 SGPTGANMTNAPT------------DNNKGEKLTCKAT--------ALPAPSVKRDTVKSVAASG 500

  Fly   290 AEEEEVANEEG--------------NQQAPQVPSENNNIPKPCNNL--AINQKQPLTPLSPRALP 338
            .:|...|..||              |..:...| ::.::|....||  ||...|.          
Mouse   501 GQEGHTAPGEGRKPPALSELSTGEENSSSDSDP-DSTSLPSAAQNLSVAIQTSQD---------- 554

  Fly   339 PRFWLPAKCNISNRVVITDVTVNLETVTIRECKTERGFFRER 380
               |.|.: ::...|.:||||.||.|||::|..|..|||..|
Mouse   555 ---WKPTR-SLIEHVFVTDVTANLITVTVKESPTSVGFFNLR 592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PcNP_524199.1 CHROMO 25..77 CDD:214605
Cbx2XP_006532166.1 CBX7_C 553..585 CDD:319236 15/46 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2748
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T615680
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.870

Return to query results.
Submit another query.