DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pc and cbx8a

Sequence 1:NP_524199.1 Gene:Pc FlyBaseID:FBgn0003042 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_991179.2 Gene:cbx8a ZFINID:ZDB-GENE-040405-1 Length:342 Species:Danio rerio

Alignment Length:411 Identity:100/412 (24%)
Similarity:151/412 (37%) Gaps:136/412 (33%)


  Fly    25 VYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYEQTNKSSGT--PSKRGI 87
            |:|||.||::|:::|.:||.||||||:|:|:|||||.||||.||...:|:..:....  |.||| 
Zfish    10 VFAAESIIKRRIRRGRMEYLVKWKGWSQKYSTWEPEENILDERLFAAFEEREREREMYGPKKRG- 73

  Fly    88 KKKEKEPDPEPESEEDEYTFTENDVDTHQATTSSATHDKESKKEKKHHHHHHHHHHIK------- 145
                    |:||      ||              ....|...|.|.:.........|:       
Zfish    74 --------PKPE------TF--------------LMKAKAKAKSKTYEFGREMSRDIRVSFPVAE 110

  Fly   146 ----SERNSGRRSESPLTHHHHHHHHESKRQRIDHSSSSNSSFTHNSFV--------------PE 192
                .....|.|:..| |.......:..:..|:....|...:.||.:.:              |:
Zfish   111 PVVTPRAREGLRTVVP-TIFPPSTINRGESVRVRPPDSERDTLTHGTSIQCPLDFTNSPKKRGPK 174

  Fly   193 P---DSNSSSSEDQPLIGTKRKAEVLKESGKIGVTIKTSPDGPTIKPQPTQ---QVTPSQQQPFQ 251
            |   .:..||||     |.||||:                :..:.:|..|:   :.:......|.
Zfish   175 PKMHPAGGSSSE-----GIKRKAD----------------ESLSYRPSKTERSGETSNCDIMHFT 218

  Fly   252 DQQQAEKIASEAATQLKSEQQATPLATEAINTTPAESGAEEEEVANEEG---------------- 300
            .:.:||                       .|....:.|:...:|....|                
Zfish   219 QKYKAE-----------------------TNHDGKQMGSRSSDVKFSHGGSFLKAGLGILGHRQK 260

  Fly   301 -------NQQAPQVPSENNNIPKPCNNLAINQKQPLTPLSPRALPPRFWLPAKCNISNRVVITDV 358
                   ||||.......||:.:     :.:|.:....||......:.|||...|: .::|:|||
Zfish   261 VGSGGAINQQAKMKHPPKNNLFR-----STDQTREQLSLSFVDDTDQSWLPCLKNM-EKIVVTDV 319

  Fly   359 TVNLETVTIRECKTERGFFRE 379
            |.|..||||:|..|::|||:|
Zfish   320 TSNSLTVTIKESSTDKGFFKE 340

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PcNP_524199.1 CHROMO 25..77 CDD:214605 30/52 (58%)
cbx8aNP_991179.2 Chromo <27..57 CDD:278797 21/30 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2748
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4652
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1628171at2759
OrthoFinder 1 1.000 FOG0001702
OrthoInspector 1 1.000 T596423
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46389
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2447
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
88.050

Return to query results.
Submit another query.