DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cb and Cpr78Ca

DIOPT Version :8

Sequence 1:NP_001262144.1 Gene:Cpr78Cb / 40353 FlyBaseID:FBgn0037068 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_649298.2 Gene:Cpr78Ca / 40352 FlyBaseID:FBgn0037067 Length:127 Species:Drosophila melanogaster

Alignment Length:128 Identity:44/129 (34%)
Similarity:70/129 (54%) Gaps:12/129 (9%)


  Fly     1 MRNFLIGMVLLALIWVEVDARLVRVRRIRRLVGASERDARITDFRVSPTDDEGVFKYAFKTSNGI 65
            |.:|  |.:::.|:.|.|  :|:...|..    |...| |...:|.:|.|..|.:.:.|:|:|||
  Fly     1 MMSF--GKIVVFLVLVLV--QLIHCTRFT----APSLD-RTIYYRNTPPDPFGHYSFEFQTTNGI 56

  Fly    66 DVQAAGSPLETIGIYSYTSPEGVPIETRYIADELGFHVVGRHLPQPPPTPDYILRSLEYIRTH 128
            ..:.||:....:|:..:.||||:|:...|:||..|:...|.|:   |..|.:::|.|||||||
  Fly    57 TTKGAGNENGAVGVVQFVSPEGIPVTFSYVADANGYQPTGDHI---PAIPLHVIRQLEYIRTH 116

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr78CbNP_001262144.1 Chitin_bind_4 55..101 CDD:278791 17/46 (37%)
Cpr78CaNP_649298.2 Chitin_bind_4 46..92 CDD:278791 17/46 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131260539
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.