DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cb and Cpr49Ah

DIOPT Version :9

Sequence 1:NP_649299.2 Gene:Cpr78Cb / 40353 FlyBaseID:FBgn0037068 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster


Alignment Length:85 Identity:32/85 - (37%)
Similarity:44/85 - (51%) Gaps:10/85 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DEGVFKYAFKTSNGIDVQAAG-------SP---LETIGIYSYTSPEGVPIETRYIADELGFHVVG 105
            |:|.:|..::|.|.|..:..|       :|   |...|.|||.||||..:..:|.|||.||...|
  Fly    62 DDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQYTADENGFRATG 126

  Fly   106 RHLPQPPPTPDYILRSLEYI 125
            .|:|.||..|:.|.:.|:.|
  Fly   127 DHIPTPPAIPEEIQKGLDQI 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CbNP_649299.2 Chitin_bind_4 55..101 CDD:459790 19/55 (35%)
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 19/55 (35%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.