DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cb and Cpr49Ah

DIOPT Version :10

Sequence 1:NP_649299.2 Gene:Cpr78Cb / 40353 FlyBaseID:FBgn0037068 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster


Alignment Length:85 Identity:32/85 - (37%)
Similarity:44/85 - (51%) Gaps:10/85 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DEGVFKYAFKTSNGIDVQAAG-------SP---LETIGIYSYTSPEGVPIETRYIADELGFHVVG 105
            |:|.:|..::|.|.|..:..|       :|   |...|.|||.||||..:..:|.|||.||...|
  Fly    62 DDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQYTADENGFRATG 126

  Fly   106 RHLPQPPPTPDYILRSLEYI 125
            .|:|.||..|:.|.:.|:.|
  Fly   127 DHIPTPPAIPEEIQKGLDQI 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CbNP_649299.2 Chitin_bind_4 55..101 CDD:459790 19/55 (35%)
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 19/55 (35%)

Return to query results.
Submit another query.