DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cb and Cpr49Ac

DIOPT Version :8

Sequence 1:NP_001262144.1 Gene:Cpr78Cb / 40353 FlyBaseID:FBgn0037068 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_725150.2 Gene:Cpr49Ac / 36348 FlyBaseID:FBgn0033725 Length:324 Species:Drosophila melanogaster

Alignment Length:111 Identity:32/112 (29%)
Similarity:49/112 (44%) Gaps:27/112 (24%)


  Fly    50 DDEGVFK--------------YAFKTSNGI--DVQA-----AGSPLETIGIYSYTSPEGVPIETR 93
            ||||..|              :::.|.|||  :.||     .|:..:  |.|.||..:|......
  Fly   156 DDEGRHKILHKEEVRKQDKYDHSYLTENGIYGEEQAKLHHTGGTHAK--GFYEYTGDDGKLYRVN 218

  Fly    94 YIADELGFHVVGRHLPQPPPTPDYILRSLEYI-RTHTEDGNLKNPH 138
            |.:::.||...|.|:   .|.||.|:|:|:|: ..|..:|..:..|
  Fly   219 YASNDGGFMPQGDHI---HPIPDAIVRALKYVEEQHKINGGAQFDH 261

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr78CbNP_001262144.1 Chitin_bind_4 55..101 CDD:278791 15/67 (22%)
Cpr49AcNP_725150.2 Chitin_bind_4 175..226 CDD:278791 14/53 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47869
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.