DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cb and Cpr47Ec

DIOPT Version :8

Sequence 1:NP_001262144.1 Gene:Cpr78Cb / 40353 FlyBaseID:FBgn0037068 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster

Alignment Length:44 Identity:16/45 (36%)
Similarity:21/45 (47%) Gaps:4/45 (9%)


  Fly    58 AFKTSNGIDVQAAGSPLETIGIYSYTSPEGVPIETRYIADELGF 101
            ||....|.|.:|    ||..|.|.|.:.:|..:|..|.|.:.||
  Fly    59 AFLVDKGTDEEA----LEVKGSYKYINEDGQEVEVFYTAGKNGF 98

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr78CbNP_001262144.1 Chitin_bind_4 55..101 CDD:278791 15/43 (35%)
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:278791 15/43 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.