DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment park and park

DIOPT Version :10

Sequence 1:NP_730600.1 Gene:park / 40336 FlyBaseID:FBgn0041100 Length:482 Species:Drosophila melanogaster
Sequence 2:XP_061499460.1 Gene:park / 1277163 VectorBaseID:AGAMI1_007112 Length:533 Species:Anopheles gambiae


Alignment Length:146 Identity:31/146 - (21%)
Similarity:48/146 - (32%) Gaps:50/146 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DPWMREYNEA---LKLSEDINGMMSERNASGLTGPD------------------------AQRRA 43
            :|:.|..::.   |:|:|. |..:|.:...||..|:                        ||..|
Mosquito   565 EPFFRVISQKAPYLQLNEQ-NEQVSNKFGLGLICPNIVTDDSHIIQTHTTTMDMYDEVLMAQDAA 628

  Fly    44 SAIRRKITIL-GTRLDSLQSLLVKVPGKQHVSEKEMNRRKDMV--------------------GN 87
            .|:|.:|... .|.|.:.:|||.. |...|..::.:....|..                    |.
Mosquito   629 HAMRARIQASPATALRAPESLLTP-PASSHKPDEYLGDEGDETGARSGISSTTTCCNTAASNKGG 692

  Fly    88 LRSKTNQVASALNMSN 103
            ..|..|.|.|..:.||
Mosquito   693 KSSSNNSVTSCSSRSN 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parkNP_730600.1 Ubl_parkin 32..105 CDD:340496 24/117 (21%)
RING0_parkin 159..250 CDD:412057
zf-RING_14 249..337 CDD:465601
BRcat_RBR_parkin 322..398 CDD:439001
Rcat_RBR_parkin 428..481 CDD:439018
parkXP_061499460.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.