DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ac78C and Adcy2

Sequence 1:NP_001262138.1 Gene:Ac78C FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:NP_112269.1 Gene:Adcy2 RGDID:619965 Length:1090 Species:Rattus norvegicus

Alignment Length:1328 Identity:409/1329 (31%)
Similarity:638/1329 (48%) Gaps:315/1329 (24%)


  Fly   312 LERS----YLTYTHRQRQKSLIIVNVVDFVLKIV----LAFVWIMRRSELGPIESDDGTSM---- 364
            |:||    |.:|....:|..||:     |:|.||    ||.:.:.  ..|| :|.:|..:.    
  Rat    25 LQRSRDWLYESYYCMSQQHPLIV-----FLLLIVMGACLALLAVF--FALG-LEVEDHVAFLITV 81

  Fly   365 --ATAITWSVCCGIANMAICFLGYWRCFANNYLHWAAVCTWVLFNIQGFV----GQGVGFADREY 423
              |.||.:::.     :.:|....::    ..|...::..|:.....|::    |..|...|:  
  Rat    82 PTALAIFFAIF-----ILVCIESVFK----KLLRVFSLVIWICLVAMGYLFMCFGGTVSAWDQ-- 135

  Fly   424 LVWYILFVIFVPYAMLPLPLKWCVVGGTITASCHLAVITIIKLQHGEATIN-PECVLFQIFANFI 487
             |.:.||:|||.|.|||..::..::...:|:|.|..|:::    :..||.. .|.:.:||.||.|
  Rat   136 -VSFFLFIIFVVYTMLPFNMRDAIIASILTSSSHTIVLSV----YLSATPGAKEHLFWQILANVI 195

  Fly   488 LYTAINVAGMYTKYLTDRGQRLAFIETHKAMEHKKESEKELQRTQKLLDSILPNIVNNQIRSEMY 552
            ::...|:||.|.|:|.:...:..:.:|...::.:.:.|.|.::.::||.|:||..:..::::|:.
  Rat   196 IFICGNLAGAYHKHLMELALQQTYRDTCNCIKSRIKLEFEKRQQERLLLSLLPAHIAMEMKAEII 260

  Fly   553 ------KGTDPTVETQFNKLYVYPMDNVSILFADIKGFTELASKTSAQQLVKILNDLFARFDRIA 611
                  |.........|:.|||....|||||:|||.|||.|||..|..:||.:||:||.:||:||
  Rat   261 QRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADIVGFTRLASDCSPGELVHMLNELFGKFDQIA 325

  Fly   612 EDNHCLRVKLLGDCYYCVSQFESDNWKTRPDHAVCSVETGLHMIKAIKDVRLHTHVDLNMRIGIH 676
            ::|.|:|:|:|||||||||....    :.|:||...|:.||.|.:|||.||..|.||:|||:|:|
  Rat   326 KENECMRIKILGDCYYCVSGLPI----SLPNHAKNCVKMGLDMCEAIKKVRDATGVDINMRVGVH 386

  Fly   677 SGSVMCGVLGNKKWHFDVWSNDVIIANHMESGGIPGRVHISEATLKCLNDAYEVEPGNGGCRDNH 741
            ||:|:|||:|.:||.:||||:||.:|||||:||:|||||||..||:.||.||:||.|:|..||.:
  Rat   387 SGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHISSVTLEHLNGAYKVEEGDGEIRDPY 451

  Fly   742 LKMLNVKTYLIKRTEPLRPKRRFGTRSSAHLAGSVATAAPPCATPTALPKSISASGSGSIGGVTA 806
            ||...||||.:     :.||..  .||..||.....|.                           
  Rat   452 LKQHLVKTYFV-----INPKGE--RRSPQHLFRPRHTL--------------------------- 482

  Fly   807 TGNDGASIDG--RSLEYAATIAVPAQQPTQLLQQQQKKNISLNSLPNVVEGVAMDSRRIRNGCGV 869
               |||.:..  |...|..:..  |.:|...|..:                   ||....||   
  Rat   483 ---DGAKMRASVRMTRYLESWG--AAKPFAHLHHR-------------------DSMTTENG--- 520

  Fly   870 MGGAGGTGGGGTGPCGMSTVSSPTAMMSAPLEVQLRPRNGACSIQNLAEAIDGKGLIIEDESTTD 934
                                                                       ..||||
  Rat   521 -----------------------------------------------------------KISTTD 526

  Fly   935 WIPEIPFKNLNSPEDGLNRADSILVDTKEDHRVSVAVLDEEIDEFIEQNIQ-INSNKE-IRREYL 997
                :|.        |.:...:..:.||...:    ..:||::|.:.|.|. ||:.|: ::.|.:
  Rat   527 ----VPM--------GQHNFQNRTLRTKSQKK----RFEEELNERMIQAIDGINAQKQWLKSEDI 575

  Fly   998 NPWTLKFKDKSQEQKFCQLREDMFRSNMLCVFVIWIFMVLCQVIIIPRCTRLIICLSVGTVILTF 1062
            ...:|.|.:|:.|:::.......|:..:.|..:|::.:.:.|::::|:.:  |:..|.|...|:.
  Rat   576 QRISLLFYNKNIEKEYRATALPAFKYYVTCACLIFLCIFIVQILVLPKTS--ILGFSFGAAFLSL 638

  Fly  1063 CCVLVMAEEFPG-LPRCLKTNSAKLVHQRQRRTLFICGVIVSMCMLSAIGLVLCPSSTYIGTADE 1126
            ..:|.:.  |.| |.:|.|..|..|                 |.:|.:.|::.            
  Rat   639 IFILFVC--FAGQLLQCSKKASTSL-----------------MWLLKSSGIIA------------ 672

  Fly  1127 HSRFLRMVSPYSNISMTEKEFKLNVYLSATIHHNITISTPASGGPTPLVDITSSGPSDEFVRSTL 1191
             :|      |:..||:|       :..:|.|                                 |
  Rat   673 -NR------PWPRISLT-------IVTTAII---------------------------------L 690

  Fly  1192 NALTLNLTPPLPQSHRPYTLTTNGHSVSLSNLSYSDASVMQSSSDVEGQCAHPE------YLVFT 1250
            .....|:           ...:|....:|...:.|:|:|  |..|.:....|..      |.:::
  Rat   691 TMAVFNM-----------FFLSNSEETTLPTANTSNANV--SVPDNQASILHARNLFFLPYFIYS 742

  Fly  1251 WVLCLVSLATALKLYYLVKAL-MALAMVAFYTTLIMMKFGSGDSFSLVELSRLGM-----PLG-V 1308
            .:|.|:|.:..|::.|.:|.| |.:|:|.:.|.|:.......|::|.|...|.|:     .:| |
  Rat   743 CILGLISCSVFLRVNYELKMLIMMVALVGYNTILLHTHAHVLDAYSQVLFQRPGIWKDLKTMGSV 807

  Fly  1309 QMLILLISFLVMVCYHARLVEVTSRLDFIWKEQAERELTNMKSNRALNDTLIKNILPDHVATYYL 1373
            .:.|..|:.||:    .|..|...||||:||.:.::|...:::...||..|::|:||.|||.::|
  Rat   808 SLSIFFITLLVL----GRQSEYYCRLDFLWKNKFKKEREEIETMENLNRVLLENVLPAHVAEHFL 868

  Fly  1374 SDE-HTDELYSKMHNLCGVMFASIPNFQDFYSE-DID-NGKACIRILNEIICDFDELLEEPRFAS 1435
            :.. ..:|||.:.::...|||||||:|::||:| |:: .|..|:|:|||||.|||:||.:|:|:.
  Rat   869 ARSLKNEELYHQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSG 933

  Fly  1436 VEKIKTVGATYMAAAGL----NHEHLRLRGETSEDSVCDLVEFAFAMKQKLEEINGDAFNNFQLR 1496
            ||||||:|:|||||.||    :.||.: ..|.....:..:||||:|:..||:.||..:||:|:||
  Rat   934 VEKIKTIGSTYMAATGLSAIPSQEHAQ-EPERQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLR 997

  Fly  1497 VGICSGPLVSGVIGARKPVYDIWGNTVNVASRMDSTGENWRVQVPENTAELLCSRGYTCVKRGEI 1561
            |||..||:::|||||:||.||||||||||||||||||...::||.|.|:.:|.:.||||..||.|
  Rat   998 VGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGII 1062

  Fly  1562 AVKGKGMMTTFYVH---PKGISESQLIS 1586
            .|||||.:.|::|:   .:.:|:|.|.|
  Rat  1063 NVKGKGDLKTYFVNTEMSRSLSQSNLAS 1090

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831 65/258 (25%)
CYCc 526..729 CDD:214485 105/209 (50%)
Guanylate_cyc 566..753 CDD:278633 108/187 (58%)
DUF1053 929..1020 CDD:283888 21/93 (23%)
CYCc 1353..1554 CDD:214485 108/208 (52%)
Guanylate_cyc 1381..1576 CDD:278633 109/204 (53%)
Adcy2NP_112269.1 AC_N <32..259 CDD:292831 62/251 (25%)
CYCc 235..438 CDD:214485 104/207 (50%)
Guanylate_cyc 280..464 CDD:278633 108/193 (56%)
DUF1053 494..598 CDD:283888 29/203 (14%)
CYCc 847..1055 CDD:214485 108/209 (52%)
Guanylate_cyc 877..1076 CDD:278633 109/200 (55%)
Interaction with GNAS. {ECO:0000269|PubMed:11087399} 904..921 8/17 (47%)
Interaction with GNAS. {ECO:0000269|PubMed:11087399} 989..992 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.