DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ac78C and ACXE

Sequence 1:NP_001262138.1 Gene:Ac78C FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:NP_652601.3 Gene:ACXE FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster

Alignment Length:1412 Identity:325/1413 (23%)
Similarity:523/1413 (37%) Gaps:485/1413 (34%)


  Fly   328 LIIVNVVDFVLKIVLAFVWIMRRSELGPIESDDGTSMATAITWSVCCGIANMAICFLGYWRCFAN 392
            ||:|..|:|..:.:....|.|..|.:                      .|::.:.|........:
  Fly    90 LILVLSVNFCDEFIAKHTWYMYASSI----------------------FASLTLVFADLTESIYH 132

  Fly   393 NYLHWAAVCTWVLFNIQGFVGQGVGFADREYLVWYILFVIFVPYAMLPLPLKWCVVGGTITASCH 457
            .|.|     :|:|.                  .:|..::|::.|..||:..        |:.:..
  Fly   133 TYAH-----SWILG------------------TFYDTYIIYMIYMFLPIHF--------ISGAVL 166

  Fly   458 LAVIT--------IIKLQHGEATINPECVLFQI---FANFILYTAINVAGMYTKYLTDRGQRLAF 511
            ||::.        :|.:..|.|..  ...||.:   ..:.:.|..:|:.|::.:.:.|...|.:|
  Fly   167 LALLVSGLYILYFVIFIAQGFAQF--ASALFSVGGMSVDIVHYLCLNLVGIFYRVMNDTVVRSSF 229

  Fly   512 IETHKAMEHKKESEKELQRTQKLLDSILPNIVNNQIRSEM-------------YKGTDPTVETQF 563
            ::.|:.::.|........:.::|||||||..::..::.::             :...:.|:..| 
  Fly   230 LDRHQYIKEKIWLRNARLQEKQLLDSILPPQISLPLQKDIQGRIVMAKQGIHSWTAMERTMAIQ- 293

  Fly   564 NKLYVYPMDNVSILFADIKGFTELASKTSAQQLVKILNDLFARFDRIAEDNHCLRVKLLGDCYYC 628
                ::|  :||||:||:..:|.|.:..:.:.|||:|:||:.|||..|......|:|.|||||||
  Fly   294 ----IHP--DVSILYADVVNYTHLTTTLTVEMLVKVLHDLYGRFDLAAYRYKVQRIKFLGDCYYC 352

  Fly   629 VSQFESDNWKTRPDHAVCSVETGLHMIKAIKDVRLHTHVDLNMRIGIHSGSVMCGVLGNKKWHFD 693
            |:.....:    ||||...|..||.||..|.:||....:|:|||||:|||::..||:|..|..||
  Fly   353 VAGLSDPD----PDHANNCVILGLSMINHIMEVRDIHGLDINMRIGVHSGNLFAGVIGEAKLQFD 413

  Fly   694 VWSNDVIIANHMESGGIPGRVHISEATLKCLN-DAYEVEPGNGGCRDNH-LKMLNVKTYLIKRTE 756
            :|..||.|||.:||.|:||.||||.|||..|: :.:::|.|....||:. ||...:::|:|    
  Fly   414 IWGLDVTIANVLESTGVPGCVHISGATLNNLDVNRFDIEDGPEEARDHPLLKKYRIRSYII---- 474

  Fly   757 PLRPKRRFGTRSSAHLAGSVATAAPPCATPTALPKSISASGSGSIGGVTATGNDGASIDGRSLEY 821
              |.........|....|.:              .|||....|:...:    :|.|:...|:|.:
  Fly   475 --RQDLHMDDEDSDEFLGDL--------------HSISLCNMGAQPRI----SDSANQSLRALFH 519

  Fly   822 AATIAVPAQQPTQLLQQQQKKNISLNSLPNVVEGVAMDSRRIRNGCGVMGGAGGTGGGGTGPCGM 886
                       .:|.::.:|..:|           |...:|:                 .|.|..
  Fly   520 -----------EELREEFRKMPVS-----------AFSPKRL-----------------LGICRF 545

  Fly   887 STVSSPTAMMSAPLEVQLRPRNGACSIQNLAEAIDGKGLIIEDESTTDWIPEIPFKNLNSPEDGL 951
            :|                                 ||              |:|           
  Fly   546 NT---------------------------------GK--------------EVP----------- 552

  Fly   952 NRADSILVDTKEDHRVSVAVLDEEIDEFIEQNIQINSNKEIRREYLNPWTLKFKDKSQEQKFCQL 1016
                                        ..||:.|              .|.|.|...|:.:.:.
  Fly   553 ----------------------------AHQNLNI--------------CLTFTDPILERAYLKQ 575

  Fly  1017 REDMFRSNMLCVFVIWIFMVLCQVIIIPRCTRLIICLS---VGTVILTFCCVLVMAEEFP----- 1073
            .:.|::.:     :|....|.|.::.|......:||.|   :...:.|..|:|.:...:.     
  Fly   576 TDYMYKYS-----IILSASVGCSLVYIELMDTQMICSSCFVLPASVATIQCILALIAWYKKYCWT 635

  Fly  1074 -----GLPRCLKTNSAKL--VHQRQRRTLFICGVIVSMCMLSAIGLVLCPSSTYIGTADEHSRFL 1131
                 .:|......|..:  :|.:...:|.|...|....|:|:. .|:|                
  Fly   636 RYGRNNVPHHYNGFSCFIFRIHDKILNSLPIRICIYLFLMISSF-FVMC---------------- 683

  Fly  1132 RMVSPYSNISMTEKEFKLNVYLSATIHHNITISTPASGGPTPLVDITSSGPSDEFVRSTLNALTL 1196
                 ...:|...:||:: .|:...:.|                                     
  Fly   684 -----LIVMSCQREEFEM-AYIEERLFH------------------------------------- 705

  Fly  1197 NLTPPLPQSHRPYTLTTNGHSVSLSNLSYSDASVMQSSSDVEGQCAHPEYLVFTWVLC-LVSLAT 1260
                                        |...:.:         |.||      ||.. ::||..
  Fly   706 ----------------------------YEQEAHI---------CFHP------WVTTNMLSLMI 727

  Fly  1261 ALKLYY-----LVKALMALAMVAFYTTLIMMKFG-------SGDSFSLVELSRLGMPLGVQMLIL 1313
            .|...:     :||..:|:.....|..||..:|.       :.:.:...|.:        ..|::
  Fly   728 CLTFTFAHIPIMVKTAVAILETLAYLLLIFFQFDFVFHHSVTTNPYFKSEYA--------HALLI 784

  Fly  1314 LISFLVMVCYHARLVEVTSRLDFIW-----KEQAERELTNMKSNRALNDTLIKNILPDHVATYYL 1373
            .|:||:|. ...|.:|.|::::|.|     ||:....|||......||     ||||.|:...||
  Fly   785 CITFLIMF-VKERQIEFTNKVNFNWRVDLRKEENAASLTNHSIIIILN-----NILPSHIVDVYL 843

  Fly  1374 SDEHTDELYSKMHNLCGVMFASIPNFQ-DFYSEDIDNGKACIRILNEIICDFDELL---EEPRFA 1434
            :.....|||.:.:.:..||||.:.||: |..|         :|:|||||.:||.||   :|  :.
  Fly   844 NSLAKHELYFENYRMVSVMFAMLINFEMDLRS---------LRVLNEIIAEFDTLLLFYKE--YY 897

  Fly  1435 SVEKIKTVGATYMAAAGLNHEHLRLRGETS----------------------EDSVCDLVEFAFA 1477
            :|||||.||.|||||.||:   |...|.||                      :.|..||.|..|.
  Fly   898 TVEKIKIVGCTYMAACGLD---LNFAGSTSTNRKESIPPTEFNEEQSRRILFQQSNEDLDEVVFV 959

  Fly  1478 M--------------KQKLEEINGDA-FNNFQLRVGICSGPLVSGVIGARKPVYDIWGNTVNVAS 1527
            |              .:..:.|.||. ..:..:.:||.||.:::|::||.:|.||||||.||:||
  Fly   960 MTSYALDMMRTLAKSNEAYQSIAGDRNITDGTIAIGISSGEVMAGIVGASQPHYDIWGNPVNMAS 1024

  Fly  1528 RMDSTGENWRVQVPENTAELLCSRGYTCVKRGEIAVKGKGMMTTFYVHPKGISESQLISP---VR 1589
            ||:|||....:.|.|.|:|:|...|.||..||...|||:|.:.|:.|   ||.|:....|   .|
  Fly  1025 RMESTGLPGHIHVTEETSEILQQFGITCSYRGMTFVKGRGKIPTYLV---GIDENLNFIPQKATR 1086

  Fly  1590 MPAGIPLAQTPNLQRQTSHHGSFSAVVFGMLQASKRSTAIAGTPTGT 1636
            .|:....:...:||...:|              ::.:.:||.|...|
  Fly  1087 FPSHQERSTVISLQSTYTH--------------AENNNSIASTSRHT 1119

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831 42/234 (18%)
CYCc 526..729 CDD:214485 84/217 (39%)
Guanylate_cyc 566..753 CDD:278633 83/189 (44%)
DUF1053 929..1020 CDD:283888 9/91 (10%)
CYCc 1353..1554 CDD:214485 87/242 (36%)
Guanylate_cyc 1381..1576 CDD:278633 87/236 (37%)
ACXENP_652601.3 AC_N <31..272 CDD:318454 42/237 (18%)
Nucleotidyl_cyc_III 290..459 CDD:325147 78/180 (43%)
Nucleotidyl_cyc_III 851..1071 CDD:325147 86/234 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45627
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.