DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10588 and AT2G41790

DIOPT Version :8

Sequence 1:NP_001287135.1 Gene:CG10588 / 40316 FlyBaseID:FBgn0037037 Length:1058 Species:Drosophila melanogaster
Sequence 2:NP_181710.1 Gene:AT2G41790 / 818778 AraportID:AT2G41790 Length:970 Species:Arabidopsis thaliana

Alignment Length:1023 Identity:287/1024 (28%)
Similarity:479/1024 (47%) Gaps:117/1024 (11%)


  Fly    46 DSKLYRALTLSNGLRAMLISDSYIDEPSIHRASRESLNSSTENFNGKLAACAVLVGVGSFSEPQQ 110
            |::.||.:.|.|.|:.:||||...|:                      .|.::.|.|||||:||.
plant    21 DNREYRMIVLKNLLQVLLISDPDTDK----------------------CAASMSVSVGSFSDPQG 63

  Fly   111 YQGLAHFVEHMIFMGSEKFPVENEFDSFVTKSGGFSNAHTENEETCFYFELDQTHLDRGMDLFMN 175
            .:|||||:|||:|..|||:|.|:.:..::|:.||.:||:|.:|||.::|:::....|..:|.|..
plant    64 LEGLAHFLEHMLFYASEKYPEEDSYSKYITEHGGSTNAYTASEETNYHFDVNADCFDEALDRFAQ 128

  Fly   176 LMKAPLMLPDAMSRERSAVQSEFEQTHMRDEVRRDQILASLASEGYPHGTFSWGNYKTL-----K 235
            ....|||..||..||..||.||.::..:.|..|..|:...|:.|.:|:..||.||..||     .
plant   129 FFIKPLMSADATMREIKAVDSENQKNLLSDGWRIRQLQKHLSKEDHPYHKFSTGNMDTLHVRPQA 193

  Fly   236 EGVDDSSLHKELHKFYRDHYGSNRMVVALQAQLSLDELEELLVRHCADIPTSQQNSIDVSQLNYQ 300
            :|||..|   ||.|||.:||.:|.|.:.:..:.|||::::|:.|...:|   |..:..|.:...|
plant   194 KGVDTRS---ELIKFYEEHYSANIMHLVVYGKESLDKIQDLVERMFQEI---QNTNKVVPRFPGQ 252

  Fly   301 KAFRDQFYKDVFLVQ--PVEDVCKLELTWVLPPMKNFYRSKPDMFISQLIGYEGVGSLCAYLRHH 363
            ....|...   .||:  |::...||.::|.:.|..:.|...|..::..|||:||.|||...|:..
plant   253 PCTADHLQ---ILVKAIPIKQGHKLGVSWPVTPSIHHYDEAPSQYLGHLIGHEGEGSLFHALKTL 314

  Fly   364 LWCISVVAGVAESSFDSNSIYSLFNICIYLSDDGFDHIDEVLEATFAWVKLIINSDQLQDSYKES 428
            .|...:.||..|.:.|    ||.|.:.|.|:|.|.:|:.|:|...|.:::|:..:...|..:.|.
plant   315 GWATGLSAGEGEWTLD----YSFFKVSIDLTDAGHEHMQEILGLLFNYIQLLQQTGVCQWIFDEL 375

  Fly   429 QQIENNNFRFQIEPPPIDHVQSIVESFNYLPSKDVLTGPQLYFQYEESAIELLRQHMNKFNFNIM 493
            ..|....|.:|.:.||:.::..|..:....|:||.|.|..|..::..:.::.:...::..||.|.
plant   376 SAICETKFHYQDKIPPMSYIVDIASNMQIYPTKDWLVGSSLPTKFNPAIVQKVVDELSPSNFRIF 440

  Fly   494 ISSYIPYEKNEYDQREPWFGTQFKTISMPPKWQTMWEQSATIKELHYPQPNPFVTTDFKIHWVES 558
            ..|. .:| .:.|:.|||:.|.:....:.......|.|||....||.|.||.|:.||..:...:.
plant   441 WESQ-KFE-GQTDKAEPWYNTAYSLEKITSSTIQEWVQSAPDVHLHLPAPNVFIPTDLSLKDADD 503

  Fly   559 GKPHVSRSPKALIRNDLCELWFRQDNIFKLPDGYINLYFITPLVRESVKQYMLGVLFTYLVEFRM 623
             |..|   |..|.:.....||::.|.:|..|..|:.:.|..||...|....:|..:||.|:...:
plant   504 -KETV---PVLLRKTPFSRLWYKPDTMFSKPKAYVKMDFNCPLAVSSPDAAVLTDIFTRLLMDYL 564

  Fly   624 AEQLYPALEAGLTYGLYIGDKGLVMRVSGYNEKLPLLVEIILNMMQTIELDIGQ--------VNA 680
            .|..|.|..|||.||:.:.|.|..:.:.|||.||.:|:|.::..:...|:...:        ...
plant   565 NEYAYYAQVAGLYYGVSLSDNGFELTLLGYNHKLRILLETVVGKIANFEVKPDRFAVIKETVTKE 629

  Fly   681 FKDLKKRQIYNALINGKSLNLDLRLSILENKRFSMISKYESVDDITMDDIKSFKENFHKKMYVKG 745
            :::.|.||.|:..:...||       ||:::.:....:.:.:..:..:|:..|......:.:::.
plant   630 YQNYKFRQPYHQAMYYCSL-------ILQDQTWPWTEELDVLSHLEAEDVAKFVPMLLSRTFIEC 687

  Fly   746 LIQGNFTEDQATDLMQKVLDTYKSE------KLDNLSALDNHLLQIPLG-SYYLRAKTLNEDDSN 803
            .|.||...::|..:::.:.|...::      .|.....|.|.::::..| .|:......|..|.|
plant   688 YIAGNVENNEAESMVKHIEDVLFNDPKPICRPLFPSQHLTNRVVKLGEGMKYFYHQDGSNPSDEN 752

  Fly   804 TIITNYYQIGPSDLKMECIMDLVELIVEEPFFNQLRTQEQLGYSLGIHQRIGYGV--LAFLITIN 866
            :.:.:|.|:...|..|...:.|..|:.::..|:||||.|||||...:.||...|:  :.|:|..:
plant   753 SALVHYIQVHRDDFSMNIKLQLFGLVAKQATFHQLRTVEQLGYITALAQRNDSGIYGVQFIIQSS 817

  Fly   867 TQETKHRADYVEQRIEAFRSRMAELVSQMSDTEFKNIRETLINGKKLGDTSLDEEVLRNWSEIVT 931
            .:...|....||..::.|.|::.|    ||:.:||:....||:.|.....:|.||....|.||.:
plant   818 VKGPGHIDSRVESLLKNFESKLYE----MSNEDFKSNVTALIDMKLEKHKNLKEESRFYWREIQS 878

  Fly   932 KEYFFNRIETQIQMLSHLTKEDVLNFLNDNDK---NNLRKLSVQVVGNHNQTSNSTAQASRSGSL 993
            ....|||.|.::..|..|.|:::::|.::..|   ...:.||::|.|:.:               
plant   879 GTLKFNRKEAEVSALKQLQKQELIDFFDEYIKVGAARKKSLSIRVYGSQH--------------- 928

  Fly   994 SDLLDDVQDNMANETDSAKPMTDKIRLEFLGESDDPS-SIKDIYAFKK 1040
                   ...||::.|               |...|| .|:||..|:|
plant   929 -------LKEMASDKD---------------EVPSPSVEIEDIVGFRK 954

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10588NP_001287135.1 Ptr 27..980 CDD:223956 276/961 (29%)
Peptidase_M16 85..214 CDD:279066 50/129 (39%)
Peptidase_M16_C 244..419 CDD:282978 54/177 (31%)
Peptidase_M16_M 436..720 CDD:292805 77/292 (26%)
Peptidase_M16_C 724..907 CDD:282978 46/192 (24%)
AT2G41790NP_181710.1 Ptr 15..944 CDD:223956 282/1012 (28%)
Peptidase_M16 36..171 CDD:279066 56/157 (36%)
Peptidase_M16_C 198..375 CDD:282978 57/190 (30%)
Peptidase_M16_M 383..663 CDD:292805 77/293 (26%)
Peptidase_M16_C 666..854 CDD:282978 46/192 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1008844at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126910
Panther 1 1.100 O PTHR43690
Phylome 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.