DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10588 and NRDC

DIOPT Version :8

Sequence 1:NP_001287135.1 Gene:CG10588 / 40316 FlyBaseID:FBgn0037037 Length:1058 Species:Drosophila melanogaster
Sequence 2:NP_002516.2 Gene:NRDC / 4898 HGNCID:7995 Length:1219 Species:Homo sapiens

Alignment Length:1144 Identity:340/1145 (30%)
Similarity:567/1145 (50%) Gaps:166/1145 (14%)


  Fly    39 EPD--KSDGDSKLYRALTLSNGLRAMLISD----------------------------------- 66
            :|:  ||..|.|.||.:.|.|||:|:||||                                   
Human   100 DPEIVKSPSDPKQYRYIKLQNGLQALLISDLSNMEGKTGNTTDDEEEEEVEEEEEDDDEDSGAEI 164

  Fly    67 ------SYIDEPSI-------------------HRA-------SRESLNS--------------- 84
                  .:.||...                   .||       .::.|.|               
Human   165 EDDDEEGFDDEDEFDDEHDDDLDTEDNELEELEERAEARKKTTEKQQLQSLFLLWSKLTDRLWFK 229

  Fly    85 ------------STENFNG----------------------------KLAACAVLVGVGSFSEPQ 109
                        .|.|..|                            .|:|.|:.||||||::|.
Human   230 STYSKMSSTLLVETRNLYGVVGAESRSAPVQHLAGWQAEEQQGETDTVLSAAALCVGVGSFADPD 294

  Fly   110 QYQGLAHFVEHMIFMGSEKFPVENEFDSFVTKSGGFSNAHTENEETCFYFELDQTHLDRGMDLFM 174
            ...|||||:|||:||||.|:|.||.||:|:.|.||..||.|:.|.|.|.|::.:.:....:|.:.
Human   295 DLPGLAHFLEHMVFMGSLKYPDENGFDAFLKKHGGSDNASTDCERTVFQFDVQRKYFKEALDRWA 359

  Fly   175 NLMKAPLMLPDAMSRERSAVQSEFEQTHMRDEVRRDQILASLASEGYPHGTFSWGNYKTLKEGVD 239
            .....|||:.||:.||..||.||::.....|..|::.:..|||..|:|.|.|.|||.:|||....
Human   360 QFFIHPLMIRDAIDREVEAVDSEYQLARPSDANRKEMLFGSLARPGHPMGKFFWGNAETLKHEPR 424

  Fly   240 DSSL--HKELHKFYRDHYGSNRMVVALQAQLSLDELEELLVRHCADIPTSQQNSIDVSQLNYQKA 302
            .:::  |..|.:|:..:|.|:.|.:.:|::.:||.||:.:....:.||.:.....:...|.  ..
Human   425 KNNIDTHARLREFWMRYYSSHYMTLVVQSKETLDTLEKWVTEIFSQIPNNGLPRPNFGHLT--DP 487

  Fly   303 FRDQFYKDVFLVQPVEDVCKLELTWVLPPMKNFYRSKPDMFISQLIGYEGVGSLCAYLRHHLWCI 367
            |....:..::.|.|:..:..|.:||.|||.:..||.||..:||.|:|:||.||:.::||...|.:
Human   488 FDTPAFNKLYRVVPIRKIHALTITWALPPQQQHYRVKPLHYISWLVGHEGKGSILSFLRKKCWAL 552

  Fly   368 SVVAGVAESSFDSNSIYSLFNICIYLSDDGFDHIDEVLEATFAWVKLIINSDQLQDSYKESQQIE 432
            ::..|..|:.|:.||.||:|:|.|.|:|:|::|..||....|.::|::......:..::|.::||
Human   553 ALFGGNGETGFEQNSTYSVFSISITLTDEGYEHFYEVAYTVFQYLKMLQKLGPEKRIFEEIRKIE 617

  Fly   433 NNNFRFQIEPPPIDHVQSIVESFNYLPSKDVLTGPQLYFQYEESAI-ELLRQHM-NKFNFNIMIS 495
            :|.|.:|.:..|:::|:::.|:....|.:|:|||.||.|:|:...| |.|.|.: .|.|..::..
Human   618 DNEFHYQEQTDPVEYVENMCENMQLYPLQDILTGDQLLFEYKPEVIGEALNQLVPQKANLVLLSG 682

  Fly   496 SYIPYEKNEYDQREPWFGTQFKTISMPPKWQTMWEQSATIK-ELHYPQPNPFVTTDFKIHWVESG 559
            :    .:.:.|.:|.|||||:....:...|..:|..:..:. :||.|..|.::.|||.:...:..
Human   683 A----NEGKCDLKEKWFGTQYSIEDIENSWAELWNSNFELNPDLHLPAENKYIATDFTLKAFDCP 743

  Fly   560 KPHVSRSPKALIRNDLCELWFRQDNIFKLPDGYINLYFITPLVRESVKQYMLGVLFTYLVEFRMA 624
            :   :..|..::......||:::||.||:|..||..:.|:||:::|....:|..:|..::...:|
Human   744 E---TEYPVKIVNTPQGCLWYKKDNKFKIPKAYIRFHLISPLIQKSAANVVLFDIFVNILTHNLA 805

  Fly   625 EQLYPALEAGLTYGLYIGDKGLVMRVSGYNEKLPLLVEIILNMMQTIELDIGQVNAFKDLKKRQI 689
            |..|.|..|.|.|.|..|:.||::||.|:|.|||||.::|::.:..............:..|:..
Human   806 EPAYEADVAQLEYKLVAGEHGLIIRVKGFNHKLPLLFQLIIDYLAEFNSTPAVFTMITEQLKKTY 870

  Fly   690 YNALINGKSLNLDLRLSILENKRFSMISKYES-VDDITMDDIKSFKENFHKKMYVKGLIQGNFTE 753
            :|.||..::|..|:||.|||..|:|||.||:: :|.::::.:.||.:.|..:::|:||:|||.|.
Human   871 FNILIKPETLAKDVRLLILEYARWSMIDKYQALMDGLSLESLLSFVKEFKSQLFVEGLVQGNVTS 935

  Fly   754 DQATDLMQKVLDTYKSEKLDNLSALDNHLLQIPLGSYYLRAKTLNEDDSNTIITNYYQIGPSDLK 818
            .::.|.::.|:|....:.|:....:...::::|.|.:..:.|.||:.|:|:.:|.|||.|...|:
Human   936 TESMDFLKYVVDKLNFKPLEQEMPVQFQVVELPSGHHLCKVKALNKGDANSEVTVYYQSGTRSLR 1000

  Fly   819 MECIMDLVELIVEEPFFNQLRTQEQLGYSLGIHQRIGYGVLAFLITINTQETKHRADYVEQRIEA 883
            ...:|:|:.:.:|||.|:.|||::.|||.:....|...|:|.|.:|:.||.||:.::.|:::||.
Human  1001 EYTLMELLVMHMEEPCFDFLRTKQTLGYHVYPTCRNTSGILGFSVTVGTQATKYNSEVVDKKIEE 1065

  Fly   884 FRSRMAELVSQMSDTEFKNIRETLINGKKLGDTSLDEEVLRNWSEIVTKEYFFNRIETQIQMLSH 948
            |.|...|.:..:::..|......||..|:..||.|.|||.|||:|:||::|.|:|:..:|:.|..
Human  1066 FLSSFEEKIENLTEEAFNTQVTALIKLKECEDTHLGEEVDRNWNEVVTQQYLFDRLAHEIEALKS 1130

  Fly   949 LTKEDVLNFLNDNDKNNLRKLSVQVV--GNHNQTSNSTAQASRSGSLSDLLDDVQDNMANETDSA 1011
            .:|.|::|:...:.....:.|||.||  |.:....:.|..:..|.|..:::              
Human  1131 FSKSDLVNWFKAHRGPGSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVM-------------- 1181

  Fly  1012 KPMTDKIRLEFLGES----DDPSSIKDIYAFKKDLYVFP 1046
                   :|.:|..|    |....|.||.||...|.:.|
Human  1182 -------QLTYLPTSPLLADCIIPITDIRAFTTTLNLLP 1213

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10588NP_001287135.1 Ptr 27..980 CDD:223956 326/1073 (30%)
Peptidase_M16 85..214 CDD:279066 56/157 (36%)
Peptidase_M16_C 244..419 CDD:282978 56/175 (32%)
Peptidase_M16_M 436..720 CDD:292805 90/287 (31%)
Peptidase_M16_C 724..907 CDD:282978 55/183 (30%)
NRDCNP_002516.2 Ptr 279..1157 CDD:223956 299/887 (34%)
Peptidase_M16 279..405 CDD:279066 55/126 (44%)
Peptidase_M16_C 430..616 CDD:282978 57/188 (30%)
Peptidase_M16_M 621..902 CDD:292805 90/288 (31%)
Peptidase_M16_C 907..1089 CDD:282978 55/182 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1025
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 624 1.000 Inparanoid score I851
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1008844at2759
OrthoFinder 1 1.000 FOG0004760
OrthoInspector 1 1.000 T609965
orthoMCL 1 0.900 OOG5_126910
Panther 1 1.100 O PTHR43690
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.840

Return to query results.
Submit another query.