DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10588 and Ide

DIOPT Version :8

Sequence 1:NP_001287135.1 Gene:CG10588 / 40316 FlyBaseID:FBgn0037037 Length:1058 Species:Drosophila melanogaster
Sequence 2:NP_524182.3 Gene:Ide / 40248 FlyBaseID:FBgn0001247 Length:990 Species:Drosophila melanogaster

Alignment Length:1034 Identity:273/1035 (26%)
Similarity:475/1035 (46%) Gaps:112/1035 (11%)


  Fly    41 DKSDGDSKLYRALTLSNGLRAMLISDSYIDEPSIHRASRESLNSSTENFNGKLAACAVLVGVGSF 105
            :||..|::.||.|.|.|||:.:||||.                      |..::|.|:.|.||..
  Fly    28 EKSLQDTRDYRGLQLENGLKVLLISDP----------------------NTDVSAAALSVQVGHM 70

  Fly   106 SEPQQYQGLAHFVEHMIFMGSEKFPVENEFDSFVTKSGGFSNAHTENEETCFYFELDQTHLDRGM 170
            |:|....|||||.|||:|:|:||:|.||.:.:::::|||.|||.|....|.::|.:....||..:
  Fly    71 SDPTNLPGLAHFCEHMLFLGTEKYPHENGYTTYLSQSGGSSNAATYPLMTKYHFHVAPDKLDGAL 135

  Fly   171 DLFMNLMKAPLMLPDAMSRERSAVQSEFEQTHMRDEVRRDQILASLASEGYPHGTFSWGNYKTLK 235
            |.|.....|||..|.|..||.:||.||.|:....|..|..|:...||...:.:..|..||..||.
  Fly   136 DRFAQFFIAPLFTPSATEREINAVNSEHEKNLPSDLWRIKQVNRHLAKPDHAYSKFGSGNKTTLS 200

  Fly   236 E-----GVDDSSLHKELHKFYRDHYGSNRMVVALQAQLSLDELEELLVRHCADIPTSQQNSIDVS 295
            |     .:|   :..||.||::..|.:|.|.:|:..:.||||||.:::...::|   :..::.|.
  Fly   201 EIPKSKNID---VRDELLKFHKQWYSANIMCLAVIGKESLDELEGMVLEKFSEI---ENKNVKVP 259

  Fly   296 QLNYQKAFRDQFYKDVFLVQPVEDVCKLELTWVLPPMKNFYRSKPDMFISQLIGYEGVGSLCAYL 360
            ... :..:.::.|.....:.|::|:..|.:::....:..||:|.||.:::.|||:||.||:.:.|
  Fly   260 GWP-RHPYAEERYGQKVKIVPIKDIRSLTISFTTDDLTQFYKSGPDNYLTHLIGHEGKGSILSEL 323

  Fly   361 RHHLWCISVVAGVAESSFDSNSIYSLFNICIYLSDDGFDHIDEVLEATFAWVKLIINSDQLQDSY 425
            |...||..::||    ..::.:.:..|:|.:.|:.:|.:|:|::::..|.:::::......:..:
  Fly   324 RRLGWCNDLMAG----HQNTQNGFGFFDIVVDLTQEGLEHVDDIVKIVFQYLEMLRKEGPKKWIF 384

  Fly   426 KESQQIENNNFRFQIEPPPIDHVQSIVESFNYLPSKDVLTGPQLYFQYEESAIELLRQHM--NKF 488
            .|..::....|||:.:..|.:.|...|.|....|.::||..|.|..::....|:.|...:  :|.
  Fly   385 DECVKLNEMRFRFKEKEQPENLVTHAVSSMQIFPLEEVLIAPYLSNEWRPDLIKGLLDELVPSKS 449

  Fly   489 NFNIMISSYIPYEKNEYDQREPWFGTQFKTISMPPKWQTMWEQSATIKELHYPQPNPFVTTDFKI 553
            ...|:..|:.|    :.|..||::.|::....:.......||.....:.|....||.|:.|:|.|
  Fly   450 RIVIVSQSFEP----DCDLAEPYYKTKYGITRVAKDTVQSWENCELNENLKLALPNSFIPTNFDI 510

  Fly   554 HWVESGKPHVSRSPKALIRNDLCELWFRQDNIFKLPDGYINLYFITPLVRESVKQYMLGVLFTYL 618
            ..|.:..|   :.|..::...:..:|.:|||.|..|...:......|:.........|..:...|
  Fly   511 SDVPADAP---KHPTIILDTPILRVWHKQDNQFNKPKACMTFDMSNPIAYLDPLNCNLNHMMVML 572

  Fly   619 VEFRMAEQLYPALEAGLTYGLYIGDKGLVMRVSGYNEKLPLLVEIILNMMQTIELDIGQ------ 677
            ::.::.|.||.|..|.|...:.....|:...:.|:::|..:|:|.:|:.:....:|..:      
  Fly   573 LKDQLNEYLYDAELASLKLSVMGKSCGIDFTIRGFSDKQVVLLEKLLDHLFDFSIDEKRFDILKE 637

  Fly   678 --VNAFKDLKKRQIYNALINGKSLNLDLRLSILENKRFSMISKYESVDDITMDDIKSFKENFHKK 740
              |.:.|:.|..|.|...|      ..|.|.:.|| .::.:...::::.:|.|.:.:|.:.|.::
  Fly   638 EYVRSLKNFKAEQPYQHSI------YYLALLLTEN-AWANMELLDAMELVTYDRVLNFAKEFFQR 695

  Fly   741 MYVKGLIQGNFTEDQATDLMQKVLDTYKSEKLDNLSALDNHLL-----QIPLGSYYLRAKTLNED 800
            ::.:..|.||.|:.||||:..:|....::.....|..|...:|     ::..|..||..|. ||.
  Fly   696 LHTECFIFGNVTKQQATDIAGRVNTRLEATNASKLPILARQMLKKREYKLLAGDSYLFEKE-NEF 759

  Fly   801 DSNTIITNYYQIGPSDLKMECIMDLVELIVEEPFFNQLRTQEQLGYSL--GIHQRIGYGVLAFLI 863
            ..::....|.|.|........:::||..::.||.::.|||:|||||.:  |:.:..|    |..|
  Fly   760 HKSSCAQLYLQCGAQTDHTNIMVNLVSQVLSEPCYDCLRTKEQLGYIVFSGVRKVNG----ANGI 820

  Fly   864 TINTQETKHRADYVEQRIEAFRSRMAELVSQMSDTEFKNIRETLINGKKLGDTSLDEEVLRNWSE 928
            .|..|..|| ..|||.|||.|.....:::..|...||:..:|.|...|.....::.::..:.:.|
  Fly   821 RIIVQSAKH-PSYVEDRIENFLQTYLQVIEDMPLDEFERHKEALAVKKLEKPKTIFQQFSQFYGE 884

  Fly   929 IVTKEYFFNRIETQIQMLSHLTKEDVLNFLND---NDKNNLRKLSVQVVGNHNQTSNSTAQASRS 990
            |..:.|.|.|.|.::.:|..::|.|.:::...   .|....|.|||.:|.               
  Fly   885 IAMQTYHFEREEAEVAILRKISKADFVDYFKKFIAKDGEERRVLSVHIVS--------------- 934

  Fly   991 GSLSDLLDDVQDNMANETDSAKPMTDKIRLEFLGESDDPSSIKDIYAFK--KDLYVFPL 1047
                      |....|.|..|:|:.       :...:....|.||..||  |:||...|
  Fly   935 ----------QQTDENATSEAEPVE-------ITNMERHKPISDIVTFKSCKELYPIAL 976

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10588NP_001287135.1 Ptr 27..980 CDD:223956 259/964 (27%)
Peptidase_M16 85..214 CDD:279066 51/129 (40%)
Peptidase_M16_C 244..419 CDD:282978 45/175 (26%)
Peptidase_M16_M 436..720 CDD:292805 66/294 (22%)
Peptidase_M16_C 724..907 CDD:282978 56/190 (29%)
IdeNP_524182.3 Ptr 25..952 CDD:223956 264/1009 (26%)
Peptidase_M16 47..185 CDD:279066 57/160 (36%)
Peptidase_M16_C 211..386 CDD:282978 45/183 (25%)
Peptidase_M16_M 395..676 CDD:292805 66/295 (22%)
Peptidase_M16_C 680..863 CDD:282978 56/189 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50491592
eggNOG 1 0.900 E1_COG1025
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1008844at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126910
Panther 1 1.100 P PTHR43690
RoundUp 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.