DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10588 and Y70C5C.1

DIOPT Version :8

Sequence 1:NP_001287135.1 Gene:CG10588 / 40316 FlyBaseID:FBgn0037037 Length:1058 Species:Drosophila melanogaster
Sequence 2:NP_507226.2 Gene:Y70C5C.1 / 190566 WormBaseID:WBGene00013492 Length:985 Species:Caenorhabditis elegans

Alignment Length:977 Identity:272/978 (28%)
Similarity:464/978 (47%) Gaps:88/978 (9%)


  Fly    31 SVVVQYHEEPDKSDGDSKLYRALTLSNGLRAMLISDSYIDEPSIHRASRESLNSSTENFNGKLAA 95
            :||::.||...|...|.:.||.|.|:||:|.:|:||...|:                      :|
 Worm     7 NVVLERHEFILKGAQDEREYRGLELTNGIRVLLVSDPTTDK----------------------SA 49

  Fly    96 CAVLVGVGSFSEPQQYQGLAHFVEHMIFMGSEKFPVENEFDSFVTKSGGFSNAHTENEETCFYFE 160
            .|:.|.||...:|.:..|||||.|||:|:|:.|:|.|||:..|:|...|.:||:|..:.|.::||
 Worm    50 AALDVNVGHLMDPWELPGLAHFCEHMLFLGTAKYPSENEYFKFLTAHAGRANANTATDHTNYFFE 114

  Fly   161 LDQTHLDRGMDLFMNLMKAPLMLPDAMSRERSAVQSEFEQTHMRDEVRRDQILASLASEGYPHGT 225
            :....|...:|.|:....:|.....|..||..||.||.......|..|..|:..|.|..|:.:|.
 Worm   115 VKPDQLPGALDRFVQFFLSPQFTESATEREVCAVDSEHSNNLNNDAWRFLQVHRSCAKPGHDYGK 179

  Fly   226 FSWGNYKTL-----KEGVDDSSLHKELHKFYRDHYGSNRMVVALQAQLSLDELEELLVRHCADIP 285
            |..||.|||     |:|::.   ...|.:|::..|.||.|...:..:.|||.||..|       .
 Worm   180 FGTGNKKTLLEDARKQGIEP---RDALLQFHKKWYSSNIMTCCIIGKESLDVLESYL-------G 234

  Fly   286 TSQQNSIDVSQLNYQ--KAF---RDQFYKDVFLVQPVEDVCKLELTWVLPPMKNFYRSKPDMFIS 345
            |.:..:||..:|..|  |.|   .:|..|.:.:| |::|..::.:::..|.:...:.|:|:.:||
 Worm   235 TFEFAAIDNKKLERQIWKEFPFGPEQLGKRIDVV-PIKDTRQISISFPFPDLTGEFLSQPEHYIS 298

  Fly   346 QLIGYEGVGSLCAYLRHHLWCISVVAG-VAESSFDSNSIYSLFNICIYLSDDGFDHIDEVLEATF 409
            .|||:||.|||.:.|:...|.:|:.:| |.:::...|     |.:.|.||.:|.:|:||:::..|
 Worm   299 HLIGHEGHGSLLSELKRLGWVVSLQSGYVVQAAGFGN-----FQVGIELSTEGLEHVDEIIQLMF 358

  Fly   410 AWVKLIINSDQLQDSYKESQQIENNNFRFQIEPPPIDHVQSIVESFNYLPSKDVLTGPQLYFQYE 474
            .::.::.:|...|..::|..::....|||:.:..|:.....:......:|.|.||:.|.|...||
 Worm   359 NYIGMMQSSGPKQWVHEELAELRAVTFRFKDKEQPMAMASCVAARLQRIPFKHVLSSPHLLTNYE 423

  Fly   475 ESAIELLRQHMNKFNFNIMISSYIPYEKNEYDQREPWFGTQFKTISMPPKWQTMWEQSATIKE-- 537
            ...|:.|...:...|..|.:.|. .::..|.:..||.:||:.|...:..:....:|::.....  
 Worm   424 PVRIKELLSMLIPSNMKIQVVSQ-KFKGQEGNTNEPVYGTEIKVTRISSETMQKYEEALKTSHHA 487

  Fly   538 LHYPQPNPFVTTDFKIHWVESGKPHVSRSPKALIRND---------LCELWFRQDNIFKLPDGYI 593
            ||.|:.|.::.|.|            .:.|:.|:::|         ...:||:||:.:|:|....
 Worm   488 LHLPEKNQYIATKF------------DQKPRELVKSDHPRLINDDEWSRVWFKQDDEYKMPKQET 540

  Fly   594 NLYFITPLVRESVKQYMLGVLFTYLVEFRMAEQLYPALEAGLTYGLYIGDKGLVMRVSGYNEKLP 658
            .|...||:|.:|.:..:|..|:...:...:||:.|.|..|||.|.|.....|:.||||||.||..
 Worm   541 KLALTTPIVSQSPRMTLLSRLWLRCLSDSLAEESYSAKVAGLNYELESSFFGVQMRVSGYAEKQA 605

  Fly   659 LLVEIILNMMQTIELDIGQVNAFKDLKKRQIYN-ALINGKSLNLDLRLSILENKRFSMISKYESV 722
            |..:.:...:...::|..:.:...|..||.:.| |......|:......::.:|.:|........
 Worm   606 LFSKHLTKRLFNFKIDQTRFDVLFDSLKRDLTNHAFSQPYVLSQHYTELLVVDKEWSKQQLLAVC 670

  Fly   723 DDITMDDIKSFKENFHKKMYVKGLIQGNFTEDQATDLMQKVLDTYKSEKLDNLSALDN-HLL--- 783
            :.:.::|::.|.:...:..:::.|:.||.||.:...|.:.::|..||....:.....| |:|   
 Worm   671 ESVKLEDVQRFGKEMLQAFHLELLVYGNSTEKETIQLSKDLIDILKSAAPSSRPLFRNEHILRRE 735

  Fly   784 -QIPLGSYYLRAKTLNEDDSNTI-ITNYYQIGPSDLKMECIMDLVELIVEEPFFNQLRTQEQLGY 846
             |:..|..|:........|...: :|  ||||..:.....::.|::.::.||.|:.|||:|.|||
 Worm   736 IQLNNGDEYIYRHLQTTHDVGCVQVT--YQIGVQNTYDNAVIGLIKNLITEPAFDTLRTKESLGY 798

  Fly   847 SLGIHQRIGYGVLAFLITINTQETKHRADYVEQRIEAFRSRMAELVSQMSDTEFKNIRETLINGK 911
            .:........|.:|..|.:...::   .|:|.:|||||...:.:.:.:|...||:|....||...
 Worm   799 IVWTRTHFNCGTVALQILVQGPKS---VDHVLERIEAFLESVRKEIVEMPQEEFENRVSGLIAQL 860

  Fly   912 KLGDTSLDEEVLRNWSEIVTKEYFFNRIETQIQMLSHLTKEDVLNFLNDNDKNNL---RKLSVQV 973
            :....:|.....:.|.||..::|.|.|||..:::|..:.||||:...:...:...   |||:|.|
 Worm   861 EEKPKTLSCRFKKFWDEIECRQYNFTRIEEDVELLKTIKKEDVIALFDKKIRKGAAERRKLAVIV 925

  Fly   974 VG 975
            .|
 Worm   926 HG 927

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10588NP_001287135.1 Ptr 27..980 CDD:223956 272/978 (28%)
Peptidase_M16 85..214 CDD:279066 44/129 (34%)
Peptidase_M16_C 244..419 CDD:282978 53/181 (29%)
Peptidase_M16_M 436..720 CDD:292805 74/296 (25%)
Peptidase_M16_C 724..907 CDD:282978 48/189 (25%)
Y70C5C.1NP_507226.2 Ptr 6..929 CDD:223956 272/978 (28%)
Peptidase_M16 36..174 CDD:279066 51/160 (32%)
Peptidase_M16_C 200..382 CDD:282978 55/195 (28%)
Peptidase_M16_M 385..669 CDD:292805 74/297 (25%)
Peptidase_M16_C 672..850 CDD:282978 47/183 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1025
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1008844at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126910
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.