DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10588 and C02G6.2

DIOPT Version :8

Sequence 1:NP_001287135.1 Gene:CG10588 / 40316 FlyBaseID:FBgn0037037 Length:1058 Species:Drosophila melanogaster
Sequence 2:NP_504531.2 Gene:C02G6.2 / 182128 WormBaseID:WBGene00015360 Length:816 Species:Caenorhabditis elegans

Alignment Length:887 Identity:221/888 (25%)
Similarity:394/888 (44%) Gaps:154/888 (17%)


  Fly    31 SVVVQYHEEPDKSDGDSKLYRALTLSNGLRAMLISDSYIDEPSIHRASRESLNSSTENFNGKLAA 95
            ::|::.:....|...|.:..|.|.|:||||.:|:||...|:                      :|
 Worm     7 NIVLKRYNSIVKGPQDERECRGLELTNGLRVLLVSDPTTDK----------------------SA 49

  Fly    96 CAVLVGVGSFSEPQQYQGLAHFVEHMIFMGSEKFPVENEFDSFVTKSGGFSNAHTENEETCFYFE 160
            .::.|..|...:|.:..|||||.|||:|:|:.|:|:||||..|::.:.|..||.||.:.|.::|:
 Worm    50 VSLAVKAGHLMDPWELPGLAHFCEHMLFLGTSKYPLENEFTKFLSDNAGSYNACTEPDHTYYHFD 114

  Fly   161 LDQTHLDRGMDLFMNLMKAPLMLPDAMSRERSAVQSEFEQTHMRDEVRRDQILASLASEGYPHGT 225
            :....|...:|.|:.....|.....|..||..||.||.......|..|..|:..||:..|:.:..
 Worm   115 VKPDQLYGALDRFVQFFLCPQFTKSATEREVCAVDSEHLSNLNSDYWRILQVDRSLSRPGHDNRK 179

  Fly   226 FSWGNYKTL-----KEGVDDSSLHKELHKFYRDHYGSNRMVVALQAQLSLDELEELLVRHCADIP 285
            |..||.|||     |:|::.   ...|.:||:..|.||.|...:..:.|||.||..|        
 Worm   180 FCTGNKKTLLEDARKKGIEP---RDALLEFYKKWYSSNIMTCCIIGKESLDVLESYL-------- 233

  Fly   286 TSQQNSIDVSQLNYQKA-------FR---DQFYKDVFLVQPVEDVCKLELTWVLPPMKNFYRSKP 340
                .:::...:..:||       |:   ||..|.:.:| |::|...:.:.:..|.:.|.|.|:|
 Worm   234 ----RTLEFDAIQNKKAESKVWAEFQYGPDQLAKKIDVV-PIKDKKLVSIIFPFPDLNNEYLSQP 293

  Fly   341 DMFISQLIGYEGVGSLCAYLRHHLWCIS-------VVAGVAESSFDSNSIYSLFNICIYLSDDGF 398
            ..:|:.|||::|.||:.:.|:...|..|       :.||           :..||:.:.||.:|.
 Worm   294 GHYIAHLIGHKGPGSISSELKRLGWASSLKPESKTIAAG-----------FGYFNVTMDLSTEGL 347

  Fly   399 DHIDEVLEATFAWVKLIINSDQLQDSYKESQQIENNNFRFQIEPPPIDHVQSIVESFNYLPSKDV 463
            :|:||:::..|.::.::.::...|..::|..::....|||:...|...:...:..:..|:|.:.:
 Worm   348 EHVDEIIQLMFNYIGMLQSAGPQQWIHEELAELSAIEFRFKDREPLTKNAIKVARNLQYIPFEHI 412

  Fly   464 LTGPQLYFQYEESAIELLRQHMNKFNFNIMISSYIPYEKNEYDQREPWFGTQFKTISMPPKWQTM 528
            |:...|..:|....|:.|...:...|..:.:.|. .:::.|.:..||.:||:.|...:.|:....
 Worm   413 LSSRYLLTKYNPERIKELLSTLTPSNMLVRVVSK-KFKEQEGNTNEPVYGTEMKVTDISPEKMKK 476

  Fly   529 WEQSATIKE--LHYPQPNPFVTTDFKIHWVESGKPHVSRSPKALIRNDLCELWFRQDNIFKLPDG 591
            :|.:.....  ||.|:.|.::.|.|.....||.|   :..|:.:..:....:||:||:.:.:|..
 Worm   477 YENALKTSHHALHLPEKNEYIVTKFDQKPRESVK---NEHPRLISDDGWSRVWFKQDDEYNMPKQ 538

  Fly   592 YINLYFITPLVRESVKQYMLGVLFTYLVEFRMAEQLYPALEAGLTYGLYIGDKG----------- 645
            ...|.|.||:|.::....::..|:.:.:...:.|:.|.|..|||.:.|..|..|           
 Worm   539 ETKLAFTTPIVAQNPIMSLISSLWLWCLNDTLTEETYNAAIAGLKFQLESGHNGVHEQAGNWLDP 603

  Fly   646 -----LVMRVSGYNEKLPLLVEIILNMMQTIELDIGQVN-AFKDLKKRQIYNALINGKSLNLDLR 704
                 :.:.|.||:||.||.|:.:...|...::|..:.: .|:.||:.                 
 Worm   604 ERHASITLHVYGYDEKQPLFVKHLTKCMTNFKIDRTRFDVVFESLKRS----------------- 651

  Fly   705 LSILENKRFS---MISKY-------ESV----------DDITMDDIKSFKENFHKKMYVKGLIQG 749
               |.|..||   |:|||       |.|          |..|::|::.|.:...:..:::..:.|
 Worm   652 ---LTNHAFSQPYMLSKYFNELLVVEKVWSKEQLLAVCDSATLEDVQGFSKELFQAFHLELFVHG 713

  Fly   750 NFTEDQATDLMQKVLDTYKSEKLDNLSALDNHLL-----------QIPLGSYYLRAKTLNEDDSN 803
            |.||.:|..|..:::|..||      :|.::.||           |:..|..|:........|:.
 Worm   714 NSTEKKAIQLSNELMDILKS------AAPNSRLLYRNEHNPRREFQLNNGDEYIYRHLQKTHDAG 772

  Fly   804 TI-ITNYYQIGPSDLKMECIMDLVELIVEEPFFNQLRTQEQL 844
            .: :|  ::.|..:.....:..|:..::.:|.|:.|||:|.|
 Worm   773 CVEVT--FKFGVQNTYDNALAGLISQLIRQPAFSTLRTKESL 812

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10588NP_001287135.1 Ptr 27..980 CDD:223956 221/888 (25%)
Peptidase_M16 85..214 CDD:279066 42/129 (33%)
Peptidase_M16_C 244..419 CDD:282978 48/192 (25%)
Peptidase_M16_M 436..720 CDD:292805 72/313 (23%)
Peptidase_M16_C 724..907 CDD:282978 29/134 (22%)
C02G6.2NP_504531.2 PqqL 31..451 CDD:223685 125/470 (27%)
Peptidase_M16 36..174 CDD:279066 49/160 (31%)
Peptidase_M16_C 200..377 CDD:282978 50/201 (25%)
Peptidase_M16_M 385..685 CDD:292805 74/324 (23%)
Peptidase_M16_C 688..>812 CDD:282978 28/132 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1025
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S927
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1008844at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126910
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.