DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32432 and lrp8

DIOPT Version :10

Sequence 1:NP_649266.1 Gene:CG32432 / 40310 FlyBaseID:FBgn0052432 Length:1307 Species:Drosophila melanogaster
Sequence 2:XP_073809120.1 Gene:lrp8 / 557734 ZFINID:ZDB-GENE-050506-134 Length:1008 Species:Danio rerio


Alignment Length:139 Identity:37/139 - (26%)
Similarity:48/139 - (34%) Gaps:44/139 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 LAPGSSSTGCSLAEFSCSNGRCVPLSKYCNNLNDCGDGSDEPRFCTRCNRTYYGDIGQTYALELH 269
            |....::..|...:|.|.||||:|....|::.:||.|.|||    ..|                 
Zfish    19 LVVNGTNLDCESGQFQCRNGRCIPTPWRCDDDDDCSDNSDE----ENC----------------- 62

  Fly   270 RPKQDRVPFVCVLT-FTAAGGQHGDVVQVTLDSFTIGRFTSYVHEGCPDGYMQIAESA----RTP 329
             ||:     .|..| |....||           ...||:.......||||..: |:||    ..|
Zfish    63 -PKK-----TCATTDFACKNGQ-----------CVPGRWRCDGEPECPDGSDE-ADSACSRQTCP 109

  Fly   330 IGGMWCGSS 338
            .....||.|
Zfish   110 PEKFDCGGS 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32432NP_649266.1 LDLa 214..245 CDD:197566 13/30 (43%)
CUB 503..646 CDD:238001
LDLa 1203..1231 CDD:197566
lrp8XP_073809120.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.