DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32432 and LRP5

DIOPT Version :10

Sequence 1:NP_649266.1 Gene:CG32432 / 40310 FlyBaseID:FBgn0052432 Length:1307 Species:Drosophila melanogaster
Sequence 2:XP_011543331.1 Gene:LRP5 / 4041 HGNCID:6697 Length:1662 Species:Homo sapiens


Alignment Length:283 Identity:60/283 - (21%)
Similarity:91/283 - (32%) Gaps:115/283 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 AAGFPSSSSSISSSLGPGKPVNLQL--------APGSSSTGCSLA----EFSCSNGRCVPLSKYC 233
            ||.||.:.         |:.|:|:|        ...|....|...    :|.|::|:||.:.:.|
Human  1309 AAQFPCAR---------GQCVDLRLRCDGEADCQDRSDEADCDAICLPNQFRCASGQCVLIKQQC 1364

  Fly   234 NNLNDCGDGSDEPRFCTRCNRTYYGDIGQTYALELHRPKQDRVPFVCVLTFTAAGGQHGDVVQVT 298
            ::..||.|||||    ..|              |:.:|..|..|        |.....|.|:.:.
Human  1365 DSFPDCIDGSDE----LMC--------------EITKPPSDDSP--------AHSSAIGPVIGII 1403

  Fly   299 LDSFTIG------------RFTS----YVHE---GCPD---GYMQIAESARTPIGGMWCGSSW-- 339
            |..|.:|            |:..    :.||   |.|.   .::....|...|..|:.||.|.  
Human  1404 LSLFVMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGIACGKSMMS 1468

  Fly   340 --------GPVLFY-------------SETRSLIFT------IRLNRLARDQSGYNFDFRIRYKV 377
                    |.|..|             |.|::.::.      ..|:|:|                
Human  1469 SVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPGLGSGCMLSRMA---------------- 1517

  Fly   378 LSRDSSVTRYGGIKLA-ELAQWH 399
            |....|.|.:|.:.:. ...|||
Human  1518 LETHISPTPFGKLHVGLGCRQWH 1540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32432NP_649266.1 LDLa 214..245 CDD:197566 12/34 (35%)
CUB 503..646 CDD:238001
LDLa 1203..1231 CDD:197566
LRP5XP_011543331.1 YncE 34..223 CDD:442618
LY 111..151 CDD:214531
Ldl_recept_b 172..212 CDD:459654
LY 196..238 CDD:214531
LY 239..273 CDD:214531
FXa_inhibition 308..345 CDD:464251
LY 375..415 CDD:214531
LY 417..459 CDD:214531
LY 460..503 CDD:214531
LY 504..546 CDD:214531
LY 547..580 CDD:214531
FXa_inhibition 614..649 CDD:464251
NHL 694..887 CDD:302697
LY 719..761 CDD:214531
NHL repeat 729..765 CDD:271320
LY 762..805 CDD:214531
NHL repeat 772..811 CDD:271320
NHL repeat 856..880 CDD:271320
FXa_inhibition 915..950 CDD:464251
LY 979..1018 CDD:214531
LY 1069..1112 CDD:214531
LY 1113..1155 CDD:214531
FXa_inhibition 1226..1262 CDD:464251
Ldl_recept_a 1267..1304 CDD:395011
LDLa 1307..1341 CDD:238060 9/40 (23%)
LDLa 1345..1379 CDD:238060 13/37 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.