DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32432 and Lrp5

DIOPT Version :10

Sequence 1:NP_649266.1 Gene:CG32432 / 40310 FlyBaseID:FBgn0052432 Length:1307 Species:Drosophila melanogaster
Sequence 2:NP_032539.2 Gene:Lrp5 / 16973 MGIID:1278315 Length:1614 Species:Mus musculus


Alignment Length:259 Identity:60/259 - (23%)
Similarity:89/259 - (34%) Gaps:97/259 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 GFPSSSSS--------ISSSLGP---GKPVNLQL--------APGSSSTGCSLA----EFSCSNG 224
            |||..:..        .|:|..|   |:.|:|:|        ...|....|...    :|.|::|
Mouse  1281 GFPECADQSDEEGCPVCSASQFPCARGQCVDLRLRCDGEADCQDRSDEANCDAVCLPNQFRCTSG 1345

  Fly   225 RCVPLSKYCNNLNDCGDGSDEPRFCTRCNRTYYGDIGQTYALELHRPKQDRVPFVCVLTFTAAGG 289
            :||.:.:.|::..||.|||||    ..|              |:::|..|.:|        |...
Mouse  1346 QCVLIKQQCDSFPDCADGSDE----LMC--------------EINKPPSDDIP--------AHSS 1384

  Fly   290 QHGDVVQVTLDSFTIG------------RFTS----YVHE---GCPD---GYMQIAESARTPIGG 332
            ..|.|:.:.|..|.:|            |:|.    :.||   |.|.   .::....|...|..|
Mouse  1385 AIGPVIGIILSLFVMGGVYFVCQRVMCQRYTGASGPFPHEYVGGAPHVPLNFIAPGGSQHGPFPG 1449

  Fly   333 MWCGSS----------WGPVLFY-------------SETRSLIFTIRLN---RLARDQSGYNFD 370
            :.|..|          .|.|..|             |.|::.::...||   ..|.|.|.||.|
Mouse  1450 IPCSKSVMSSMSLVGGRGSVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNVD 1513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32432NP_649266.1 LDLa 214..245 CDD:197566 12/34 (35%)
CUB 503..646 CDD:238001
LDLa 1203..1231 CDD:197566
Lrp5NP_032539.2 YncE 4..213 CDD:442618
Beta-propeller 1 31..287
LY 101..141 CDD:214531
Ldl_recept_b 162..202 CDD:459654
LY 186..228 CDD:214531
LY 229..270 CDD:214531
LDL-receptor class B 5 247..289
FXa_inhibition 298..335 CDD:464251
Beta-propeller 2 340..601
LY 365..405 CDD:214531
LY 407..449 CDD:214531
LY 450..493 CDD:214531
LY 494..536 CDD:214531
LY 537..570 CDD:214531
FXa_inhibition 604..639 CDD:464251
Beta-propeller 3 643..902
YncE <653..781 CDD:442618
LY 709..751 CDD:214531
LY 798..837 CDD:214531
LY 837..878 CDD:214531
FXa_inhibition 905..940 CDD:464251
Beta-propeller 4 944..1211
LY 969..1008 CDD:214531
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1002..1025
LY 1059..1102 CDD:214531
LY 1103..1145 CDD:214531
FXa_inhibition 1216..1252 CDD:464251
LDLa 1258..1294 CDD:238060 3/12 (25%)
LDLa 1297..1331 CDD:238060 8/33 (24%)
LDLa 1335..1369 CDD:238060 13/37 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1474..1498 2/23 (9%)
PPPSP motif A 1499..1505 0/5 (0%)
PPPSP motif B 1537..1544
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1567..1599
PPPSP motif C 1573..1580
PPPSP motif D 1590..1595
PPPSP motif E 1604..1611
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.