DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11456 and Zfp787

DIOPT Version :8

Sequence 1:NP_001262130.1 Gene:CG11456 / 40309 FlyBaseID:FBgn0037031 Length:445 Species:Drosophila melanogaster
Sequence 2:XP_017444956.1 Gene:Zfp787 / 365176 RGDID:1310536 Length:391 Species:Rattus norvegicus

Alignment Length:299 Identity:70/300 (23%)
Similarity:104/300 (35%) Gaps:99/300 (33%)


  Fly   167 NYKSPISALVWRHMQVHKKWRPRVLRSLAAVQRRRKLKEQSAEMAAQPAALPPSSKKNKYYAEKT 231
            ::::|:..|:.....| ..|.|..|               |...:|.|...||..:....|   .
  Rat    32 SHENPVDILIMDDDDV-PSWPPNKL---------------SPPQSAPPPGPPPRPRPPAPY---I 77

  Fly   232 CEICNRKFVNGKTLSKHVKT---------------------------VHNKIKPFICNVCGKKTA 269
            |..|.:.|.:...|::|.:|                           :|...||:.|:.|||:.:
  Rat    78 CTECGKSFSHWSKLTRHQRTHTGERPNACTDCGKTFSQSSHLVQHRRIHTGEKPYACSECGKRFS 142

  Fly   270 RKASLIIHMRQHTGEKPLQCGECKFSTRDPSVLHKHRQRHDSQDTRSSLK---CSQCDYFCIQAN 331
            ..::|:.|.|.||||||..|.:|..|......|.|||:.|      |.||   |.:|.....|..
  Rat   143 WSSNLMQHQRIHTGEKPYTCPDCGRSFTQSKSLAKHRRSH------SGLKPFVCPRCGRGFSQPK 201

  Fly   332 ALKRHMRLNHAEAYRDLCCDICSFTSINVERLRAHKQDHRQGLITNCEDSMDARAAGFKYPRKVG 396
            :|.||:|| |.|         .|...:..:.|.|                 ..|.|  |.|.:..
  Rat   202 SLARHLRL-HPE---------LSGPGVAAKVLAA-----------------SVRRA--KAPEEAT 237

  Fly   397 DKNGEISADCFMPLESVDSLPHEPALDTGGVTIPAPPSE 435
            ..:|||:.               |..|..|:.:..||.:
  Rat   238 AADGEIAI---------------PVGDGEGIIVVGPPGD 261

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11456NP_001262130.1 C2H2 Zn finger 232..253 CDD:275368 6/48 (13%)
C2H2 Zn finger 261..281 CDD:275368 7/20 (35%)
C2H2 Zn finger 289..309 CDD:275368 7/20 (35%)
Zfp787XP_017444956.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24408
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.