DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11456 and hang

DIOPT Version :8

Sequence 1:NP_001262130.1 Gene:CG11456 / 40309 FlyBaseID:FBgn0037031 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001138204.1 Gene:hang / 32613 FlyBaseID:FBgn0026575 Length:2223 Species:Drosophila melanogaster

Alignment Length:551 Identity:99/552 (18%)
Similarity:170/552 (31%) Gaps:211/552 (38%)


  Fly    11 CSLCLRQYDLQEDLRGHLVYFHG--------------------YEPISTPSVKNKTAK--TSTKE 53
            |.||..::..::.|:.||...||                    |...|......::..  ||...
  Fly  1308 CKLCNAEFAYEKGLKVHLFKVHGKAIKDEMIIKQFECDVCSIVYSSESELQQHKRSVHKLTSASA 1372

  Fly    54 QTAAGSNSQ-DKQTVVERSENSEPPASELQPMPFKDFRLVLRANMLEPCSFG------------K 105
            .|:|.::|: |..:::   ::.:|.:|:|             |::....:.|            |
  Fly  1373 STSASTSSKIDDDSLM---DDGKPTSSDL-------------ADLSTLAAGGSTASAPLYWYQCK 1421

  Fly   106 ECPFKFQDATKMELHCSCH---KGGSFSCCECGMELPNWRRCSAHLWKAH-QV--DVDLLVC-PV 163
            .||..|....|:.:|.:.|   ....:||.:||......:....|.:|.| ||  ..:..:| .|
  Fly  1422 YCPSNFNTNKKLAIHINSHDEFDSNDYSCKDCGNVYSGRKSLWVHRYKKHPQVPNPAECSLCRKV 1486

  Fly   164 F-----------ECNYKSPISALVWRHMQ------VHKKWRPRVLRSLAA-------VQRRRKLK 204
            |           .||.| ||:: ...|.|      .|...:..:.|....       ...:::|:
  Fly  1487 FFDRQMHDNHTPTCNRK-PITS-TGAHQQQDGQLHSHHTAKRTIFRHKTGDDDDEEDDDEQQQLE 1549

  Fly   205 EQ--------SAEMAAQPAALPPSSKKNKYYAEKTCEICNRKFVNGKTLSKHVKTVH-------- 253
            |:        :..:|:...|...:|.|.: ..|..|.||..:|.:.:..|||::. |        
  Fly  1550 ERANSDGNGTTVGVASGSTAAAGTSLKIR-IPEVACTICGARFTDQEHFSKHIQK-HEQELYVDN 1612

  Fly   254 ---------------------NKIKPFICNVCGKKTARKASLIIHMRQH---------------- 281
                                 |:...:.|::|.|...:..:|.:|.:.|                
  Fly  1613 PLAAMFDDGPADAGQFQVERQNENGEYACDLCAKTFPQVIALKVHRKWHFRGDSKQNPIDGEATQ 1677

  Fly   282 -----------------------TGEKPLQCGECKFSTRDPSVLHKHR---QRHDSQDTRSSLKC 320
                                   .|..|.|..:...::.:.|:.|.:.   .|..|...:..|||
  Fly  1678 LTNNNHTTNNNNNNSMHLRELHAVGLMPNQQQQSLNNSCNSSMNHNNNSSSNRSKSMKRKRELKC 1742

  Fly   321 SQCDYFCIQANALKRHM-----------------------------------------RLNHAEA 344
            ..|....|..|.|:|||                                         :|..|:.
  Fly  1743 EYCASTFISNNNLRRHMYELHKHEVSNLPEPPVIVVDDHLTCRRCQLKFDTKELWIEHKLADAKV 1807

  Fly   345 YRDLC-----CDICSFTSINVERLRAHKQDH 370
            .|..|     ||:|.......|:|..|..:|
  Fly  1808 VRPFCPFQWGCDLCGEYLSRKEKLMNHINNH 1838

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11456NP_001262130.1 C2H2 Zn finger 232..253 CDD:275368 7/21 (33%)
C2H2 Zn finger 261..281 CDD:275368 5/20 (25%)
C2H2 Zn finger 289..309 CDD:275368 3/23 (13%)
hangNP_001138204.1 zf-AD 80..154 CDD:285071
C2H2 Zn finger 1036..1057 CDD:275368
C2H2 Zn finger 1067..1088 CDD:275368
C2H2 Zn finger 1279..1298 CDD:275371
C2H2 Zn finger 1308..1325 CDD:275371 5/17 (29%)
C2H2 Zn finger 1420..1440 CDD:275368 6/20 (30%)
C2H2 Zn finger 1450..1468 CDD:275368 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24408
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.