DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11456 and pzf-1

DIOPT Version :8

Sequence 1:NP_001262130.1 Gene:CG11456 / 40309 FlyBaseID:FBgn0037031 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001256688.1 Gene:pzf-1 / 188142 WormBaseID:WBGene00011505 Length:504 Species:Caenorhabditis elegans

Alignment Length:424 Identity:76/425 (18%)
Similarity:129/425 (30%) Gaps:123/425 (29%)


  Fly   116 KMELHCSCHKGGSFSCCECGMELPNWRRCSAHLWKAHQV-DVDLLVCPVFECNYKSPISALVWRH 179
            :.:.|.:||     .|..|...:|.......|:...|.: .:.:.||    ||:.......:..|
 Worm    31 RRQRHMTCH-----MCLLCNRRIPENETLREHMKNKHNIWKLFICVC----CNWSFGTEIYLKCH 86

  Fly   180 MQVHKK-WRPRVLRSLA--------------------------------------AVQRRRKLK- 204
            .:..|. .||.:|:.||                                      ::.:...|| 
 Worm    87 EECMKSTGRPGLLKPLAMPMTAPAREASALNTDPQNGSDDVPHSSPSPVPMIAENSIIQASSLKM 151

  Fly   205 ------EQSAEMAAQPAALPPSSKKNK---------YYAE--------------KTCEICNRKFV 240
                  ::|:...:.|..|...:.:.|         ::.|              .||.:|||:..
 Worm   152 EPIESADRSSASTSTPRTLVSGTPREKIPCGFCGKDFFHEGSLREHRRRFHMTGHTCLLCNRQIP 216

  Fly   241 NGKTLSKHVKTVHNKIKPFICNVCGKKTARKASLIIHMR--QHTGEKPLQCGECK-------FST 296
            ..:|:..|:|:.||..|.:.|..|......:..||.|..  :.||:...:.|..:       .|.
 Worm   217 ENETVRDHMKSQHNIKKVYNCLCCNWTFLNQVHLISHKTCLKQTGKPCCRPGHMEPLAIPRTASI 281

  Fly   297 RDPSVLHKHRQRHDSQDTRSS------LKCSQCDYFCIQANALKRHMRLNHAEAYRDLCCDICSF 355
            |....|....|..|......|      |.|..|..|.....:|.:|.|..|...:   .|.:|:.
 Worm   282 RQFFTLKTETQSGDDDSAAGSQLFSARLSCKSCGKFFYSERSLSKHHRQIHMSGH---VCVLCNH 343

  Fly   356 TSINVERLRAH-KQDHRQGLITNCEDSMDARAAGFKYP------------RKVGDKNG------- 400
            .......::.| :::|...|:.||      |...:.:.            :|.||...       
 Worm   344 QMPKTVTVQEHMEKEHNIRLVFNC------RCCNWSFATRRCLMSHVECLKKAGDARNVKPVAIP 402

  Fly   401 EISADCFMPLESVDSLPHEPALDTGGVTIPAPPS 434
            .::||..:...........|.......|...|.|
 Worm   403 RMAADSILQSLKESEAQEYPDFSAASTTSSGPAS 436

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11456NP_001262130.1 C2H2 Zn finger 232..253 CDD:275368 7/21 (33%)
C2H2 Zn finger 261..281 CDD:275368 5/22 (23%)
C2H2 Zn finger 289..309 CDD:275368 5/27 (19%)
pzf-1NP_001256688.1 COG5236 <13..>62 CDD:227561 7/36 (19%)
C2H2 Zn finger 181..202 CDD:275368 1/21 (5%)
C2H2 Zn finger 208..229 CDD:275368 7/21 (33%)
C2H2 Zn finger 237..253 CDD:275368 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.