DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CSN3 and COP13

Sequence 1:NP_524190.2 Gene:CSN3 FlyBaseID:FBgn0027055 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_568296.1 Gene:COP13 AraportID:AT5G14250 Length:429 Species:Arabidopsis thaliana

Alignment Length:461 Identity:148/462 (32%)
Similarity:226/462 (49%) Gaps:61/462 (13%)


  Fly     3 SALENYVNQVRTLSASGSYRELAEELPESLSLL---------------ARNWSILDNVLETLDMQ 52
            :::|..:..::.||.|          ||.||.|               ..|:|.||.    ||..
plant     6 NSVEAVITSIQGLSGS----------PEDLSALHDLLRGAQDSLRAEPGVNFSTLDQ----LDAS 56

  Fly    53 QHSLGVLYVLLAKLHSASTANPEPVQLIQLMRDFVQRNNNEQLRYAVCAFYETCHLFTEFVVQKN 117
            :||||.|| .|..|.....:..:....|.::..|:...:..|:|.|...|...|.:..:.|:...
plant    57 KHSLGYLY-FLEVLTCGPVSKEKAAYEIPIIARFINSCDAGQIRLASYKFVSLCKILKDHVIALG 120

  Fly   118 LSILGIRIISRAIDQIRQLETQLTPIHADLCLLSLKAKNFSVVLPYLDADITDISTVAAECKTQQ 182
            ..:.|:..:..|:.:::....:||.:|.|:..|.|:||::......|..||.:|           
plant   121 DPLRGVGPLLNAVQKLQVSSKRLTALHPDVLQLCLQAKSYKSGFSILSDDIVEI----------- 174

  Fly   183 QQQSQHADANNDAKYFLLYFYYGGMIYTAVKNYERALYFFEVCITTPAMAMSHIMLEAYKKFLMV 247
                   |...|   |.||.||||||...:|.:::||......:|.|...::.|.||||||:::|
plant   175 -------DQPRD---FFLYSYYGGMICIGLKRFQKALELLYNVVTAPMHQVNAIALEAYKKYILV 229

  Fly   248 SLIVEGKIA-YIPKNTQVIG-RFMKPMANHYHDLVNVYANSSSEELRIIILKYSEAFTRDNNMGL 310
            |||..|:.. .:||...... |..|.....|.:|.|.|.:....||..:::..:..|..|.|:||
plant   230 SLIHNGQFTNTLPKCASTAAQRSFKNYTGPYIELGNCYNDGKIGELEALVVARNAEFEEDKNLGL 294

  Fly   311 AKQVATSLYKRNIQRLTKTFLTLSLSDVASRVQLASAVEAERYILNMIKSGEIYASINQKDGMVL 375
            .||..:|||||||.|||:.:|||||.|:|:.|||.:|.|||.::|.||:.|:|:|.||||||||.
plant   295 VKQAVSSLYKRNILRLTQKYLTLSLQDIANMVQLGNAKEAEMHVLQMIQDGQIHALINQKDGMVR 359

  Fly   376 FKDDPEKYNSPEMFLNVQNNITHVLDQVRQINKMEEEIILNPMYVKKALGSQ------DDDLTSQ 434
            |.:|||:|.|.||...:.:.|...:...:.:..|:|.:..:|:|:.| :|.:      .||..:.
plant   360 FLEDPEQYKSSEMIEIMDSVIQRTIGLSKNLLAMDESLSCDPLYLGK-VGRERQRYDFGDDFDTV 423

  Fly   435 HPKTFS 440
             |:.||
plant   424 -PQKFS 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CSN3NP_524190.2 PCI 275..378 CDD:279707 52/103 (50%)
COP13NP_568296.1 PAM 294..381 CDD:214803 50/87 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H2710
Inparanoid 1 1.050 209 1.000 Inparanoid score I1228
OMA 1 1.010
OrthoDB 1 1.010 D929822at2759
OrthoInspector 1 1.000 T193623
orthoMCL 1 0.900 OOG5_129714
Panther 1 1.100 LDO PTHR10758
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.