DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CSN3 and cops3

Sequence 1:NP_524190.2 Gene:CSN3 FlyBaseID:FBgn0027055 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001017238.1 Gene:cops3 XenbaseID:XB-GENE-944158 Length:423 Species:Xenopus tropicalis

Alignment Length:441 Identity:229/442 (52%)
Similarity:303/442 (69%) Gaps:19/442 (4%)


  Fly     1 MGSALENYVNQVRTLSASGSYRELAEELPESLSLLARNWSILDNVLETLDMQQHSLGVLYVLLAK 65
            |.||||.:||.||.||:.|...:|.|.:.:|..|||:|.|.||.||..||:|:||||||.||..|
 Frog     1 MASALEQFVNSVRQLSSQGQMTQLCELINKSGELLAKNLSHLDTVLGALDVQEHSLGVLAVLFVK 65

  Fly    66 LHSASTANPEPVQLIQLMRDFVQRNNNEQLRYAVCAFYETCHLFTEFVVQKNLSILGIRIISRAI 130
            ....|.  |:...|...::.|:...|.|.:|||...|...||..|..:|::...:.||.::.:||
 Frog    66 FSMPSI--PDFETLFSQVQLFISTCNGEHIRYATDTFAGLCHQLTNALVERKQPLRGICVLRQAI 128

  Fly   131 DQIRQLETQLTPIHADLCLLSLKAKNFSVVLPYLDADITDISTVAAECKTQQQQQSQHADANNDA 195
            |:::....|||.||||||.|||.||.|...|.|||.|:.||      ||         .:...||
 Frog   129 DKMQMNANQLTSIHADLCQLSLLAKCFKPALAYLDVDMMDI------CK---------ENGAYDA 178

  Fly   196 KYFLLYFYYGGMIYTAVKNYERALYFFEVCITTPAMAMSHIMLEAYKKFLMVSLIVEGKIAYIPK 260
            |.||.|:||||||||.:||:||||||:|..|||||||:||||||||||:::||||:.||:..:||
 Frog   179 KPFLCYYYYGGMIYTGLKNFERALYFYEQAITTPAMAVSHIMLEAYKKYILVSLILHGKVQQLPK 243

  Fly   261 NT-QVIGRFMKPMANHYHDLVNVYANSSSEELRIIILKYSEAFTRDNNMGLAKQVATSLYKRNIQ 324
            .| |::|||:||::|.||:|..||:.::..|||.::.|::|.|||||||||.||..:||||:|||
 Frog   244 YTSQIVGRFIKPLSNAYHELAQVYSTNNPAELRNLVSKHNETFTRDNNMGLVKQCLSSLYKKNIQ 308

  Fly   325 RLTKTFLTLSLSDVASRVQLASAVEAERYILNMIKSGEIYASINQKDGMVLFKDDPEKYNSPEMF 389
            |||||||||||.|:||||||:.|.|||:|:|.||:.|||:||||||||||.|.|:|||||:|.|.
 Frog   309 RLTKTFLTLSLQDMASRVQLSGAQEAEKYVLYMIEDGEIFASINQKDGMVCFHDNPEKYNNPAML 373

  Fly   390 LNVQNNITHVLDQVRQINKMEEEIILNPMYVKKALGSQDDDLTSQHPKTFS 440
            .|:...:...:|...::..|::||.:||.:|:|::||||||..|: |.::|
 Frog   374 HNIDQEMLRCIDLDDRLKAMDQEITVNPQFVQKSMGSQDDDSGSK-PSSYS 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CSN3NP_524190.2 PCI 275..378 CDD:279707 68/103 (66%)
cops3NP_001017238.1 PCI 259..362 CDD:279707 68/103 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C262622307
eggNOG 1 0.900 E1_KOG2582
Hieranoid 1 1.000
Homologene 1 1.000 H2710
Inparanoid 1 1.050 428 1.000 Inparanoid score I1606
OMA 1 1.010
OrthoDB 1 1.010 D453056at33208
OrthoFinder 1 1.000 FOG0005253
OrthoInspector 1 1.000 T1059450
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R6002
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.