DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CSN3 and cops3

Sequence 1:NP_524190.2 Gene:CSN3 FlyBaseID:FBgn0027055 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_955979.1 Gene:cops3 ZFINID:ZDB-GENE-030131-7660 Length:423 Species:Danio rerio

Alignment Length:436 Identity:222/437 (51%)
Similarity:300/437 (69%) Gaps:20/437 (5%)


  Fly     1 MGSALENYVNQVRTLSASGSYRELAEELPESLSLLARNWSILDNVLETLDMQQHSLGVLYVLLAK 65
            |.||||.:||.||.|||.|...:|.|.:.:|..||::|.|.||.||..||:|:||||||.||..|
Zfish     1 MASALEQFVNNVRQLSAQGQMTQLCELINKSGELLSKNLSHLDTVLGALDIQEHSLGVLAVLFVK 65

  Fly    66 LHSASTAN-PEPVQLIQLMRDFVQRNNNEQLRYAVCAFYETCHLFTEFVVQKNLSILGIRIISRA 129
            .   |..| |:...|...::.|:...|.|.:|||...|...||..|..:|::...:.||.|:.:|
Zfish    66 F---SMPNIPDFETLFSQVQLFISTCNGEHIRYATDTFAGLCHQLTNALVERKQPLRGISILKQA 127

  Fly   130 IDQIRQLETQLTPIHADLCLLSLKAKNFSVVLPYLDADITDISTVAAECKTQQQQQSQHADANND 194
            ||:::....|||.:|||||.|.|.||.|...:|:|:.|:.||      ||         .:...|
Zfish   128 IDKMQMNTNQLTSVHADLCQLCLLAKCFKPAVPFLELDMMDI------CK---------ENGAYD 177

  Fly   195 AKYFLLYFYYGGMIYTAVKNYERALYFFEVCITTPAMAMSHIMLEAYKKFLMVSLIVEGKIAYIP 259
            ||:||.|:||||||||.:||:||||||||..|||||||:||||||||||:::||||:.||:..:|
Zfish   178 AKHFLCYYYYGGMIYTGLKNFERALYFFEQAITTPAMAVSHIMLEAYKKYILVSLILHGKVQQLP 242

  Fly   260 KNT-QVIGRFMKPMANHYHDLVNVYANSSSEELRIIILKYSEAFTRDNNMGLAKQVATSLYKRNI 323
            |.| |::|||:||::|.||:|..:||.::..|||.::.|:||.||||||.||.||..:||||:||
Zfish   243 KYTSQIVGRFIKPLSNAYHELAQIYATNNPAELRALVNKHSETFTRDNNSGLVKQCLSSLYKKNI 307

  Fly   324 QRLTKTFLTLSLSDVASRVQLASAVEAERYILNMIKSGEIYASINQKDGMVLFKDDPEKYNSPEM 388
            ||||||||||||.|:||||||:...|||:|:|:||:.||||||||||||||.|.|:|||||:|.|
Zfish   308 QRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIYASINQKDGMVCFHDNPEKYNNPAM 372

  Fly   389 FLNVQNNITHVLDQVRQINKMEEEIILNPMYVKKALGSQDDDLTSQ 434
            ...:...:...::...::..|::||.:||.:|:|::|:|:||:.|:
Zfish   373 LHKIDQEMLKCIELDEKLKSMDQEITVNPQFVQKSMGTQEDDVGSK 418

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CSN3NP_524190.2 PCI 275..378 CDD:279707 68/103 (66%)
cops3NP_955979.1 PCI 259..362 CDD:279707 68/103 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C262622140
eggNOG 1 0.900 E1_KOG2582
Hieranoid 1 1.000
Homologene 1 1.000 H2710
Inparanoid 1 1.050 424 1.000 Inparanoid score I1704
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D453056at33208
OrthoFinder 1 1.000 FOG0005253
OrthoInspector 1 1.000 T1052700
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10758
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R6002
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.890

Return to query results.
Submit another query.