DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CSN3 and Cops3

Sequence 1:NP_524190.2 Gene:CSN3 FlyBaseID:FBgn0027055 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001004200.1 Gene:Cops3 RGDID:1303002 Length:423 Species:Rattus norvegicus

Alignment Length:441 Identity:226/442 (51%)
Similarity:303/442 (69%) Gaps:19/442 (4%)


  Fly     1 MGSALENYVNQVRTLSASGSYRELAEELPESLSLLARNWSILDNVLETLDMQQHSLGVLYVLLAK 65
            |.||||.:||.||.|||.|...:|.|.:.:|..|||:|.|.||.||..||:|:||||||.||..|
  Rat     1 MASALEQFVNSVRQLSAQGQMTQLCELINKSGELLAKNLSHLDTVLGALDVQEHSLGVLAVLFVK 65

  Fly    66 LHSASTANPEPVQLIQLMRDFVQRNNNEQLRYAVCAFYETCHLFTEFVVQKNLSILGIRIISRAI 130
            ....|.  |:...|...::.|:...|.|.:|||...|...||..|..:|::...:.||.|:.:||
  Rat    66 FSMPSV--PDFETLFSQVQLFISTCNGEHIRYATDTFAGLCHQLTNALVERKQPLRGIGILKQAI 128

  Fly   131 DQIRQLETQLTPIHADLCLLSLKAKNFSVVLPYLDADITDISTVAAECKTQQQQQSQHADANNDA 195
            |:::....|||.:|||||.|.|.||.|...|||||.|:.||      ||         .:...||
  Rat   129 DKMQMNTNQLTSVHADLCQLCLLAKCFKPALPYLDVDMMDI------CK---------ENGAYDA 178

  Fly   196 KYFLLYFYYGGMIYTAVKNYERALYFFEVCITTPAMAMSHIMLEAYKKFLMVSLIVEGKIAYIPK 260
            |:||.|:||||||||.:||:||||||:|..|||||||:||||||:|||:::||||:.||:..:||
  Rat   179 KHFLCYYYYGGMIYTGLKNFERALYFYEQAITTPAMAVSHIMLESYKKYILVSLILLGKVQQLPK 243

  Fly   261 NT-QVIGRFMKPMANHYHDLVNVYANSSSEELRIIILKYSEAFTRDNNMGLAKQVATSLYKRNIQ 324
            .| |::|||:||::|.||:|..||:.::..|||.::.|:||.|||||||||.||..:||||:|||
  Rat   244 YTSQIVGRFIKPLSNAYHELAQVYSTNNPSELRNLVNKHSETFTRDNNMGLVKQCLSSLYKKNIQ 308

  Fly   325 RLTKTFLTLSLSDVASRVQLASAVEAERYILNMIKSGEIYASINQKDGMVLFKDDPEKYNSPEMF 389
            |||||||||||.|:||||||:...|||:|:|:||:.|||:||||||||||.|.|:|||||:|.|.
  Rat   309 RLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFASINQKDGMVSFHDNPEKYNNPAML 373

  Fly   390 LNVQNNITHVLDQVRQINKMEEEIILNPMYVKKALGSQDDDLTSQHPKTFS 440
            .|:...:...::...::..|::||.:||.:|:|::|||:|| :...|.::|
  Rat   374 HNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDD-SGNKPSSYS 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CSN3NP_524190.2 PCI 275..378 CDD:279707 68/103 (66%)
Cops3NP_001004200.1 PCI 259..362 CDD:334524 68/103 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C262621860
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H2710
Inparanoid 1 1.050 428 1.000 Inparanoid score I1651
OMA 1 1.010
OrthoDB 1 1.010 D453056at33208
OrthoFinder 1 1.000 FOG0005253
OrthoInspector 1 1.000 T1087005
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10758
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
1010.010

Return to query results.
Submit another query.