DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CSN3 and csn3

Sequence 1:NP_524190.2 Gene:CSN3 FlyBaseID:FBgn0027055 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_593155.3 Gene:csn3 PomBaseID:SPAC222.16c Length:338 Species:Schizosaccharomyces pombe

Alignment Length:347 Identity:70/348 (20%)
Similarity:128/348 (37%) Gaps:95/348 (27%)


  Fly    75 EPVQLIQLMRDFVQRNNNEQLRYAVCAFYETCHLFTEFVVQKNLSIL---------GIRIISRAI 130
            :|..|:....|||.:::.||           |:..:.:::....|:.         ...|:.:::
pombe    18 DPETLLLKFTDFVHQHSVEQ-----------CNQLSMYIIASVNSLAEAFYGSHPEKYNIVFQSV 71

  Fly   131 DQIRQLETQLTPIHADLCLL-----------SLKAKNFSVVLPYLDADITDISTVAAECKTQQQQ 184
            :.... ...::.:|  :|.|           |||:.|...|..::...|     :...|    ..
pombe    72 EYAAH-SPAISVMH--VCYLKELLRQGQYATSLKSFNDLEVSKHIPGSI-----LLQYC----MY 124

  Fly   185 QSQHADANNDAKYFLLYFYYGGMIYTAVKNYERALYFFEVCITTPAMAMSHIMLEAYKKFLMVSL 249
            .:.|...|||.                  :..:..||..:.|.|..:...|  .|||..||::.:
pombe   125 AAYHCLGNNDL------------------DSAKVWYFSILYIPTTTLTSFH--EEAYYSFLLLYI 169

  Fly   250 IVEGKIAYI----PKNTQVIGRFMKPMANHYHDLVNVYANSSSEELRIIILKYSEAFTRDNNMGL 310
            |..||...:    ..|...:.|.|.|    |.:.::.|....: .||.:|.::...|.:||:...
pombe   170 ITTGKKFQLDSATSSNVLPLKRHMVP----YEEFLDAYLKDVN-TLRTVIKEHWSRFLKDNSTAF 229

  Fly   311 AKQVATSLY-KRNIQRLTKTFLTLSLSDVASRVQLASAVEAERYILN--------MIKSGEIYAS 366
            . ..|..:| ...:::..|||.:|.|..:|.  |||.:.:..:.|:.        .:.:|||:.:
pombe   230 I-LFALEVYPMHRLKKWRKTFSSLKLEYIAK--QLAISQDVAKEIIQKFDNKTNFTVANGEIFLT 291

  Fly   367 INQKDGMVLFKDDPEKYNSPEM 388
            .|..|.:           ||||
pombe   292 FNALDDV-----------SPEM 302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CSN3NP_524190.2 PCI 275..378 CDD:279707 25/112 (22%)
csn3NP_593155.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005253
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129714
Panther 1 1.100 LDO PTHR10758
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R6002
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.