DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CSN3 and rpn3

Sequence 1:NP_524190.2 Gene:CSN3 FlyBaseID:FBgn0027055 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_595282.2 Gene:rpn3 PomBaseID:SPBC119.01 Length:497 Species:Schizosaccharomyces pombe

Alignment Length:408 Identity:84/409 (21%)
Similarity:144/409 (35%) Gaps:124/409 (30%)


  Fly    40 SILDNVLETLDMQQH----SLGVLYVLLAKLHSASTANPEPVQLIQLMRDFVQRNNNEQLRYAVC 100
            |:.:.:||.:||.|:    |..:..      .:.:|..||....:||:.......|.   :|.|.
pombe    91 SLKNELLELIDMPQNGDDSSTSITN------GNGNTIFPEVDMYLQLLLSMTLYYNE---KYEVG 146

  Fly   101 AFYETCHLFTEFVVQKNLSILGIRIIS---RAIDQI----------------RQLETQ--LTPIH 144
            |.|          ::|.::    |:.|   |.:|||                |.:|.:  |..:|
pombe   147 AEY----------IKKVIA----RLQSYDRRTLDQIAAKLYFYYILFFEKCNRSVECRNTLLSVH 197

  Fly   145 ADLCL----------LSLKAKNFSVVLPYLDAD----ITDISTVAAECKTQQQQQSQHADANNDA 195
            ....|          |:|..:|:.....|..||    .|...|.|               :||.|
pombe   198 RTASLRHDSETQAMVLTLLLRNYIQFNLYDQADRLVSKTSFLTNA---------------SNNLA 247

  Fly   196 KYFLLYFYYGGMIYTAVKNYERA-LYFFEVCITTPAMAMSHIMLEA-YKKFLMVSLIVEGKIAYI 258
               :.|.||.|.|.....:|..| .:........|....:...||| ||..::|.|:    :..|
pombe   248 ---IRYQYYLGRIRAIQLDYTTAHEHLVSAIRKAPNTVYAVQFLEAVYKLHIVVQLL----MGEI 305

  Fly   259 PKNTQVIGRFMKPMANHYHDLVNVYANSSSEE-----LRI--------------IILKYSEAFTR 304
            |:.                   .::...|.|:     |||              .:.||...|..
pombe   306 PER-------------------RIFRQKSLEKTLVPYLRISQAVRIGDLCAFTDALSKYEAEFRF 351

  Fly   305 DNNMGLAKQVATSLYKRNIQRLTKTFLTLSLSDVASRVQLASAVEAERYILNMIKSGEIYASINQ 369
            |....|..::..::.|..::.::.::..:||.||..::.|.|...||..:...|:.|.|.|||:.
pombe   352 DGLYTLICRLRHTVIKTGLRMISLSYSRISLRDVCIKLGLDSEESAEYIVAKGIRDGVIDASIDH 416

  Fly   370 KDGMVLFKDDPEKYNSPE 387
            .:..:...:..:.|::.:
pombe   417 SNAFMASNEAMDIYSTEQ 434

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CSN3NP_524190.2 PCI 275..378 CDD:279707 25/122 (20%)
rpn3NP_595282.2 PCI 322..425 CDD:279707 23/103 (22%)
Rpn3_C 428..483 CDD:285563 1/8 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.