DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CSN3 and csn-3

Sequence 1:NP_524190.2 Gene:CSN3 FlyBaseID:FBgn0027055 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_499878.3 Gene:csn-3 WormBaseID:WBGene00000815 Length:501 Species:Caenorhabditis elegans

Alignment Length:420 Identity:91/421 (22%)
Similarity:172/421 (41%) Gaps:88/421 (21%)


  Fly    80 IQLMRDFVQRNNNEQLRYAVCAFYETCH--LFTEFVV------------QKNLSILGIRIISRAI 130
            ::|:..:|..||           :...|  |..|.:.            :||...:|.|||.:|:
 Worm   111 VELLNHYVDENN-----------FVGGHLKLVPEIIFPLLRDVGLYCLEKKNKPEIGQRIIMKAL 164

  Fly   131 DQI-----RQLETQLTPIHADLCLLSLKAKNFSVVLPYLDADITDISTVAAECKTQQQQQSQHAD 190
            ..:     ......||..|..|...:|:.|:::.|.|::|..:.:|   |.|...|.|::|.:.:
 Worm   165 GSMFPRNGSNAPNVLTSAHGVLFACALETKDYASVEPFIDLHVDEI---ANENCIQDQEKSDNRE 226

  Fly   191 ----------------------ANN---DAKYFLLYFYYGGMIYTAVKNYERALYFFEVCITTPA 230
                                  |:|   ..||.|.|.|.|..|...:|.:|.||:..|:|:..||
 Worm   227 RDFGDVFLGRMKKGAAFGSQPVAHNPHLHPKYVLDYLYNGACILIELKRFEDALFLLEICVGMPA 291

  Fly   231 MAMSHIMLEAYKKFLMVSLIVEGKIAYIPKNTQVIGRFMKPMANHYHDLVNV-YANSSSEELRI- 293
            .::....|:::||::::|||::||:.......:...|..|..:..|.....: ::.||:....: 
 Worm   292 FSVQDQHLDSFKKYVLISLILKGKVDVTENGDKSAIRHFKTKSPEYKQFSEIRFSRSSNTHSAVE 356

  Fly   294 -IILKYSEAFTRDNNMGLAKQVATSLYKRNIQRLTKTFLTLSLSDVASRVQLASAVEAERYILNM 357
             ::....:...:|.|..:||.:...:.|:.|..||:.|.::.:|::.....|.|..:....|..:
 Worm   357 SLVKSAKDRLRKDGNTEIAKYLVVEMKKKTIMSLTRMFTSIRISEIEELAFLKSRDQVTELIGQL 421

  Fly   358 IKSGEIYASINQKDGMVLFKDD----PEKYNSPEMFLNVQNNITHVLDQVRQINK-----MEEEI 413
            ::...|...|   ||.::|..:    |.| |..|..:.:.:::..:|.:.....|     |...:
 Worm   422 VEEQRITVRI---DGDMVFWTELSPVPSK-NDVENKIRIVDHLNTLLHEKNTTMKAGSGRMRPSV 482

  Fly   414 ILNPMYVKKALGSQDDDLTSQHP---KTFS 440
            :.|           :|:..|..|   |.||
 Worm   483 MYN-----------EDEGLSMPPTESKFFS 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CSN3NP_524190.2 PCI 275..378 CDD:279707 21/106 (20%)
csn-3NP_499878.3 PCI 338..432 CDD:279707 17/97 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2582
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I3657
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005253
OrthoInspector 1 1.000 T474297
orthoMCL 1 0.900 OOG5_129714
Panther 1 1.100 LDO PTHR10758
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R6002
TreeFam 1 0.960
109.850

Return to query results.
Submit another query.