DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CSN3 and rpn-3

Sequence 1:NP_524190.2 Gene:CSN3 FlyBaseID:FBgn0027055 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_498869.1 Gene:rpn-3 WormBaseID:WBGene00004460 Length:504 Species:Caenorhabditis elegans

Alignment Length:535 Identity:100/536 (19%)
Similarity:177/536 (33%) Gaps:175/536 (33%)


  Fly     4 ALENYVNQVRTLSASGSY--RELAEELPESLSLLARNWSILDNVLETLDMQQHSLGVLYV--LLA 64
            |:||...|:..|.....:  ..:.:.||::..      .|.||||..|.....|....:.  :|.
 Worm    35 AVENIKEQLAALDKGEEHLITRVLQVLPKTRK------QINDNVLYKLVSSHLSSDAQFAEGMLK 93

  Fly    65 KLH---SAST-----------------------ANPEP---VQLIQLMRDFVQRNNNEQLR---- 96
            .||   :|.|                       |:||.   ::|:.|:..:.|:.|.|.|.    
 Worm    94 YLHYTPAADTEVQPMDTSNVKTKSPKKGVKPVFASPESDCYLRLLVLLHLYAQKKNTEALALGEN 158

  Fly    97 ---------------------YAVCAFYETCHLFTEFVVQKNLSILGIRIISRAIDQIRQLETQL 140
                                 |.:|..||.                    ..|..|....|.::|
 Worm   159 QLTSIYNFDRRTLDGLAAKTLYFLCVIYER--------------------EGRLFDHQGFLNSRL 203

  Fly   141 TPIHADLCLLSLKAKNFS----VVLPYLDADITDISTVAAECK--TQQQQQSQHA---------D 190
            .         :...:|||    |::.:|           ..|.  .:|.|.:.|.         .
 Worm   204 R---------TATLRNFSESQAVLICWL-----------LRCYLINRQYQSAAHLVSKVAFPDNA 248

  Fly   191 ANNDAKYFLLYFYYGGMIYTAVKNYERAL-YFFEVCITTP---AMAMSHIMLEAYKKFLMVSLIV 251
            :|||   ...|.||.|.|.....:|..|. ||.:.....|   |:...    :|.:|:::|..::
 Worm   249 SNND---LARYMYYQGRIKALQLDYNSAAGYFLQAQRKAPQEGAIGFK----QAVQKWVVVIGLL 306

  Fly   252 EGKIAYIPKNTQVIGRFMKPMAN----HYHDLVNVYANSSSEELRIIILKYSEAFTRDNNMGLAK 312
            :|:   ||..:.    |.:|:..    ||.||.....:.........:.::...|..|:.:.|..
 Worm   307 QGE---IPDRSV----FRQPIYRKCLAHYLDLSRGVRDGDVARFNHNLEQFKTQFEADDTLTLIV 364

  Fly   313 QVATSLYKRNIQRLTKTFLTLSLSDVASRVQLASAVEAERYILNMIKSGEIYASINQ--KDG--M 373
            ::..::.|..|::::..:..:.:.|:|.::.:.:..|.|..:...|..|.|.|.|..  :||  .
 Worm   365 RLRQNVIKTAIKQISLAYSRIYIKDIAKKLYITNETETEYIVAKAIADGAIDAVITSDVRDGPRY 429

  Fly   374 VLFKDDPEKYNSPEMFLNVQNNITHVL-----------------------DQVRQINKMEEEIIL 415
            :...:..:.|.:.|...:....|.:.|                       :|.|:..:.|.|.  
 Worm   430 MQSSETADIYRTSEPQAHFDTRIRYCLELHNQAVKALRYPPKKKIAVETIEQAREREQQELEF-- 492

  Fly   416 NPMYVKKALGSQDDD 430
                 .|.|..:|||
 Worm   493 -----AKELADEDDD 502

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CSN3NP_524190.2 PCI 275..378 CDD:279707 20/107 (19%)
rpn-3NP_498869.1 PCI 327..419 CDD:279707 17/92 (18%)
Rpn3_C 437..494 CDD:285563 8/64 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.