DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mst77F and CG45764

DIOPT Version :9

Sequence 1:NP_524188.1 Gene:Mst77F / 40304 FlyBaseID:FBgn0086915 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001303581.1 Gene:CG45764 / 26067042 FlyBaseID:FBgn0267411 Length:214 Species:Drosophila melanogaster


Alignment Length:215 Identity:189/215 - (87%)
Similarity:198/215 - (92%) Gaps:1/215 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNLKQKDSKPEVAVTKSVKTYKKSIEYVNSDASDIEEDINRAEDEYASSSGFVNFLRDFKKRYG 65
            ||||||||.||:|||:|||||.:|:||||.||||||:|||||.|.||||||||||||||||||||
  Fly     1 MSNLKQKDIKPDVAVSKSVKTSRKAIEYVKSDASDIDEDINRTEYEYASSSGFVNFLRDFKKRYG 65

  Fly    66 EYYSNNEIRRAAETRWNEMSFRHRCQYSAEPLDTFHVEPNSVSSLQRSSEGEHRMHSEISGCADT 130
            |||||.:|||||||||||||||||||||||||||||||||||||||||.|.|.||||||||| ||
  Fly    66 EYYSNYQIRRAAETRWNEMSFRHRCQYSAEPLDTFHVEPNSVSSLQRSIEAELRMHSEISGC-DT 129

  Fly   131 FFGAGGSNSCTPRKENKCSKPRVRKSCPKPRAKTSKQRRSCGKPKPKGARPRKACPRPRKKMECG 195
            ||||.||||||||||||||||||.|||||||||:|||||:|.|||||.|||||||||||..||||
  Fly   130 FFGACGSNSCTPRKENKCSKPRVWKSCPKPRAKSSKQRRNCAKPKPKCARPRKACPRPRNSMECG 194

  Fly   196 KAKAKPRCLKPKSSKPKCSM 215
            |.|||||||||||||||||:
  Fly   195 KPKAKPRCLKPKSSKPKCSV 214



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448463
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008561
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.