| Sequence 1: | NP_524188.1 | Gene: | Mst77F / 40304 | FlyBaseID: | FBgn0086915 | Length: | 215 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001303581.1 | Gene: | CG45764 / 26067042 | FlyBaseID: | FBgn0267411 | Length: | 214 | Species: | Drosophila melanogaster |
| Alignment Length: | 215 | Identity: | 189/215 - (87%) |
|---|---|---|---|
| Similarity: | 198/215 - (92%) | Gaps: | 1/215 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MSNLKQKDSKPEVAVTKSVKTYKKSIEYVNSDASDIEEDINRAEDEYASSSGFVNFLRDFKKRYG 65
Fly 66 EYYSNNEIRRAAETRWNEMSFRHRCQYSAEPLDTFHVEPNSVSSLQRSSEGEHRMHSEISGCADT 130
Fly 131 FFGAGGSNSCTPRKENKCSKPRVRKSCPKPRAKTSKQRRSCGKPKPKGARPRKACPRPRKKMECG 195
Fly 196 KAKAKPRCLKPKSSKPKCSM 215 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45448463 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0008561 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.930 | |||||