DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mst77F and Mst77Y-4

Sequence 1:NP_524188.1 Gene:Mst77F FlyBaseID:FBgn0086915 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001303580.1 Gene:Mst77Y-4 FlyBaseID:FBgn0267490 Length:213 Species:Drosophila melanogaster

Alignment Length:215 Identity:188/216 (87%)
Similarity:197/216 (91%) Gaps:2/216 (1%)


  Fly     1 MSNLKQKDSKPEVAVTKSVKTYKKSIEYVNSDASDIEEDINRAEDEYASSSGFVNFLRDFKKRYG 65
            ||||||||.||||||:||: |.:|:||||.||||||:||||.|||||.|||||||||||||||||
  Fly     1 MSNLKQKDIKPEVAVSKSI-TSRKAIEYVKSDASDIDEDINTAEDEYVSSSGFVNFLRDFKKRYG 64

  Fly    66 EYYSNNEIRRAAETRWNEMSFRHRCQYSAEPLDTFHVEPNSVSSLQRSSEGEHRMHSEISGCADT 130
            |||||.:|||||||||||||||||||||||||||||||||||||||||.|.|.||||||||| ||
  Fly    65 EYYSNYQIRRAAETRWNEMSFRHRCQYSAEPLDTFHVEPNSVSSLQRSIEAELRMHSEISGC-DT 128

  Fly   131 FFGAGGSNSCTPRKENKCSKPRVRKSCPKPRAKTSKQRRSCGKPKPKGARPRKACPRPRKKMECG 195
            ||||.||||||||||||||||||.|||||||||:|||||:|.|||||.|||||||||||..||||
  Fly   129 FFGACGSNSCTPRKENKCSKPRVWKSCPKPRAKSSKQRRNCAKPKPKCARPRKACPRPRNSMECG 193

  Fly   196 KAKAKPRCLKPKSSKPKCSM 215
            |.|||||||||||||||||:
  Fly   194 KPKAKPRCLKPKSSKPKCSV 213



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130790685
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.