DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HIPP1 and ECHID

DIOPT Version :9

Sequence 1:NP_649261.1 Gene:HIPP1 / 40302 FlyBaseID:FBgn0037027 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_176255.2 Gene:ECHID / 842350 AraportID:AT1G60550 Length:337 Species:Arabidopsis thaliana


Alignment Length:227 Identity:53/227 - (23%)
Similarity:89/227 - (39%) Gaps:39/227 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   679 VAHLVIH-TERGN-FGHTYSKQLLEQLNDTL--SSVARKGEFNTVLLTVEGPQ-FCQGIDCQELI 738
            :|.:.|: .||.| |.....|:|:...||..  |||      ..::||.:|.: ||.|.|.....
plant    87 IAKITINRPERRNAFRPQTVKELMRAFNDARDDSSV------GVIILTGKGTKAFCSGGDQALRT 145

  Fly   739 QGSLEKRKDSASQLAVALKCYLRTLATFPKPLVAGIVGSQINLGVMQLPFADYVVASDDCSFETN 803
            |.......|......:.|:..:|.|   |||::|.:.|..:..|.:.....|..:|:|:..|...
plant   146 QDGYADPNDVGRLNVLDLQVQIRRL---PKPVIAMVAGYAVGGGHILHMVCDLTIAADNAIFGQT 207

  Fly   804 YAKLGQLPEGYALWHGHQRVSSEVHSRL----------FLMGERLFATELLESNSFVDKICKARN 858
            ..|:|....||         .|.:.|||          |:  .|.:.....|....::.:....:
plant   208 GPKVGSFDAGY---------GSSIMSRLVGPKKAREMWFM--TRFYTASEAEKMGLINTVVPLED 261

  Fly   859 VNEMALAKAKQISTSSAEMYRTLKKLNHSAVN 890
            :.:..:...::|..:|....|.||    :|:|
plant   262 LEKETVKWCREILRNSPTAIRVLK----AALN 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HIPP1NP_649261.1 crotonase-like 673..870 CDD:119339 46/205 (22%)
ECHIDNP_176255.2 PLN02921 7..337 CDD:178509 53/227 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.