DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HIPP1 and AT4G16800

DIOPT Version :9

Sequence 1:NP_649261.1 Gene:HIPP1 / 40302 FlyBaseID:FBgn0037027 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_193413.2 Gene:AT4G16800 / 827386 AraportID:AT4G16800 Length:301 Species:Arabidopsis thaliana


Alignment Length:245 Identity:54/245 - (22%)
Similarity:100/245 - (40%) Gaps:37/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   675 KVNKVAH-----LVIHTERGNFGHTYSKQLLEQLNDTLSSVARKGEFNTVLLTVEGP-QFCQGID 733
            |:|:::.     :.::.:|....:..:|::|:.|.:...|:.:......|::....| .||.|.|
plant    44 KLNRLSGSDSGIIEVNLDRPVTKNAINKEMLKSLQNAFESIHQDNSARVVMIRSLVPGVFCAGAD 108

  Fly   734 CQELIQGSLEKRKDSASQLAVALKCYLRTLATFPK----PLVAGIVGSQINLGVMQLPFADYVVA 794
            .:       |:|..|.|::...:.. ||.:.:|.:    |.:|.|.|:.:..|:......|..:.
plant   109 LK-------ERRTMSPSEVHTYVNS-LRYMFSFIEALSIPTIAAIEGAALGGGLEMALACDLRIC 165

  Fly   795 SDDCSFETNYAKLGQLPE-GYAL---WHGHQRVS----SEVHSRLFLMGERLFATELLESNSFVD 851
            .::..|        .||| |.|:   ..|.||:|    ..|...|...|.::.|.|  .:|..:.
plant   166 GENAVF--------GLPETGLAIIPGAGGTQRLSRLVGRSVSKELIFTGRKIDAIE--AANKGLV 220

  Fly   852 KIC-KARNVNEMALAKAKQISTSSAEMYRTLKKLNHSAVNVTKFPRLDEE 900
            .|| .|...:|.|:..|:||:.......:..||.....:.......|:.|
plant   221 NICVTAGEAHEKAIEMAQQINEKGPLAIKMAKKAIDEGIETNMASGLEVE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HIPP1NP_649261.1 crotonase-like 673..870 CDD:119339 48/213 (23%)
AT4G16800NP_193413.2 PLN02600 51..300 CDD:178210 52/238 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11941
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.