DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HIPP1 and hadhab

DIOPT Version :9

Sequence 1:NP_649261.1 Gene:HIPP1 / 40302 FlyBaseID:FBgn0037027 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_001082906.1 Gene:hadhab / 793834 ZFINID:ZDB-GENE-041111-204 Length:763 Species:Danio rerio


Alignment Length:247 Identity:56/247 - (22%)
Similarity:92/247 - (37%) Gaps:52/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   699 LLEQLNDTLSSVARKGEFNTV-LLTVEGPQFCQGIDCQELI----QGSLEKRKDSASQL------ 752
            |:.||.|||....:..|..|: .|.....:..:|:..:::.    :|.::|.:|.....      
Zfish   217 LVHQLVDTLGPGLKSPEERTIEYLEEVAVEAARGLAQKKITLTKEKGWMQKIQDYVMSYPFVRQQ 281

  Fly   753 ---AVALKCYLRTLATFPKPLVAGIVGSQINLGVMQLPFADYVVASDDCSFETNYAKLGQLPEGY 814
               .|..|...:|...:|.||  .|:.| :..||.|.|...|:|.|.      .:.||....|..
Zfish   282 IYNTVEKKVMKQTKGLYPAPL--KIIES-VKAGVEQGPTTGYLVESQ------QFGKLAMTNESK 337

  Fly   815 A---LWHGHQRV--------SSEVHSRLFLMGERLFATELLESNSFVDK----ICKARNVNEMAL 864
            |   |:||....        ..||.: |.::|..|....:.:..  |||    |.|...|:.::.
Zfish   338 ALIGLYHGQVACKKNRFGTPEKEVKT-LAILGAGLMGAGIAQVT--VDKGIHTILKDTTVDGLSR 399

  Fly   865 A----------KAKQISTSSAEMYRTLKKLNHSAVNVTKFPRLDEELKVIGE 906
            .          |.|:.|.:|.|....|..|. ..::...|.:.|..::.:.|
Zfish   400 GEQQVFKGLNDKTKKKSLTSFERDTFLSNLT-GQLDYNGFNKADMIIEAVFE 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HIPP1NP_649261.1 crotonase-like 673..870 CDD:119339 48/209 (23%)
hadhabNP_001082906.1 fa_ox_alpha_mit 27..762 CDD:131494 56/247 (23%)
crotonase-like 41..251 CDD:119339 9/33 (27%)
3HCDH_N 363..541 CDD:280833 19/92 (21%)
3HCDH 544..639 CDD:279114
3HCDH 676..>750 CDD:279114
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.