DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HIPP1 and AUH

DIOPT Version :9

Sequence 1:NP_649261.1 Gene:HIPP1 / 40302 FlyBaseID:FBgn0037027 Length:926 Species:Drosophila melanogaster
Sequence 2:XP_005252123.1 Gene:AUH / 549 HGNCID:890 Length:349 Species:Homo sapiens


Alignment Length:200 Identity:43/200 - (21%)
Similarity:85/200 - (42%) Gaps:24/200 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   682 LVIHTERGNFGHTYSKQLLEQLNDTLSSVARKGEFNTVLLTVEGPQ-FCQGIDCQELIQGSLEKR 745
            :|:...|....::.||.|::.|:..:.::....:..|:::..|.|. ||.|.|.:       |:.
Human   100 VVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGADLK-------ERA 157

  Fly   746 KDSASQL---AVALKCYLRTLATFPKPLVAGIVGSQINLGVMQLPFA-DYVVASDDCSFETNYAK 806
            |.|:|::   ...::..:..:|..|.|.:|.|.|..:. |.::|..| |..||:..........|
Human   158 KMSSSEVGPFVSKIRAVINDIANLPVPTIAAIDGLALG-GGLELALACDIRVAASSAKMGLVETK 221

  Fly   807 LGQLPEGYALWHGHQRVSSEVHSRLFLMGERLFATELLESN-----SFVDKICKARNVNEMALAK 866
            |..:|.|    .|.||:...:  .:.|..|.:|:..:|:..     ..:..:.:.....:.|..|
Human   222 LAIIPGG----GGTQRLPRAI--GMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRK 280

  Fly   867 AKQIS 871
            |..::
Human   281 ALDLA 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HIPP1NP_649261.1 crotonase-like 673..870 CDD:119339 43/197 (22%)
AUHXP_005252123.1 crotonase-like 99..349 CDD:304874 43/199 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11941
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.