DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HIPP1 and echdc2

DIOPT Version :9

Sequence 1:NP_649261.1 Gene:HIPP1 / 40302 FlyBaseID:FBgn0037027 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_997953.1 Gene:echdc2 / 338247 ZFINID:ZDB-GENE-030219-147 Length:301 Species:Danio rerio


Alignment Length:226 Identity:52/226 - (23%)
Similarity:83/226 - (36%) Gaps:53/226 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   638 FVKPVSKSSQRGG----EDTSSHTLANDMKA---------NNG--SELVCLHKVNKVAHLVIHTE 687
            |..|:.:...||.    ....||...:|.|.         :||  ..|:|..:.           
Zfish     8 FAGPIKRLLPRGSFTQTRSWCSHGSVSDKKEVRLNRLEGDDNGIVEVLMCRERA----------- 61

  Fly   688 RGNFGHTYSKQLLEQLNDTLSSVARKGEFNTVLLTVEGP-QFCQGIDCQELIQGSLEKRKDSASQ 751
            |.:.||.:    :.|:.|.:||:........::.....| .||.|.|.:|..|.|     ::.::
Zfish    62 RNSLGHVF----VGQMRDLVSSLQHDSAVRVLVFRSLIPGVFCAGADLKERAQMS-----NAEAE 117

  Fly   752 LAV-ALKCYLRTLATFPKPLVAGIVGSQINLGVMQLPFADYVVASDDCS----FETNYAKLGQLP 811
            |.| .|:..:..:|..|.|.:|.:.|..:. |.::|..|..:..:..|:    .||.   .|.||
Zfish   118 LFVHGLRSLMNDIAALPMPTIAAVDGFALG-GGLELALACDLRTAAHCAQMGLIETT---RGLLP 178

  Fly   812 EGYALWHGHQR----VSSEVHSRLFLMGERL 838
            ..    .|.||    |...|...|...|.|:
Zfish   179 GA----GGSQRLPRTVGFAVAKELIFTGRRV 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HIPP1NP_649261.1 crotonase-like 673..870 CDD:119339 40/176 (23%)
echdc2NP_997953.1 crotonase-like 47..301 CDD:304874 44/187 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11941
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.