DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HIPP1 and Echdc2

DIOPT Version :9

Sequence 1:NP_649261.1 Gene:HIPP1 / 40302 FlyBaseID:FBgn0037027 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_001100145.1 Gene:Echdc2 / 298381 RGDID:1308525 Length:296 Species:Rattus norvegicus


Alignment Length:197 Identity:51/197 - (25%)
Similarity:80/197 - (40%) Gaps:32/197 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   688 RGNFGHTYSKQLLEQLNDTLSSVARKGEFNTVLL---TVEGPQFCQGIDCQELIQGSLEKRKDSA 749
            |...|:.:..:|||.|     :..|:.:...|||   .|:| .||.|.|.:       |:.:.||
  Rat    57 RNALGNVFVSELLEAL-----AQLREDQQVRVLLFRSAVKG-VFCAGADLK-------ERERMSA 108

  Fly   750 SQLAV---ALKCYLRTLATFPKPLVAGIVGSQINLGVMQLPFA-DYVVASDDCSFETNYAKLGQL 810
            :::..   .|:..:..:|.||.|.:|.:.|..:. |.::|..| |..:|:............|.|
  Rat   109 AEVGTFVQRLRGLMSEIAAFPAPTIAAMDGFALG-GGLELALACDLRIAASSAVMGLIETTRGLL 172

  Fly   811 PEGYALWHGHQR----VSSEVHSRLFLMGERL---FATELLESNSFVDKICKARNVNEMALAKAK 868
            |..    .|.||    :...:...|...|.||   .|.||...|..|.:..:.......|||.|:
  Rat   173 PGA----GGTQRLPRCLGVALAKELIFTGRRLNGVQAHELGLVNHAVAQNEEGDAAYHRALALAQ 233

  Fly   869 QI 870
            :|
  Rat   234 EI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HIPP1NP_649261.1 crotonase-like 673..870 CDD:119339 50/195 (26%)
Echdc2NP_001100145.1 crotonase-like 42..296 CDD:304874 51/197 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11941
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.