DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HIPP1 and Eci1

DIOPT Version :9

Sequence 1:NP_649261.1 Gene:HIPP1 / 40302 FlyBaseID:FBgn0037027 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_059002.2 Gene:Eci1 / 29740 RGDID:61892 Length:289 Species:Rattus norvegicus


Alignment Length:218 Identity:49/218 - (22%)
Similarity:87/218 - (39%) Gaps:34/218 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   693 HTYSKQLLEQLNDTLSSVARKGEFNTVLLTVEGPQ-FCQGIDCQELIQGSLEKRKD--SASQLAV 754
            ::.|.:.|.:...:|..:........|:||.|.|. |..|:|..|:...:.....:  .|.| .:
  Rat    55 NSLSLEFLTEFVISLEKLENDKSIRGVILTSERPGIFSAGLDLMEMYGRNPAHYAEYWKAVQ-EL 118

  Fly   755 ALKCYLRTLATFPKPLVAGIVGSQINLGVMQLPFADYVVASDDCSFE--TNYAKLG-----QLPE 812
            .|:.||..|.     |::.|.|:....|.:.....||.:.:|:..:.  .|.:.||     .|.:
  Rat   119 WLRLYLSNLT-----LISAINGASPAGGCLMALTCDYRIMADNPKYTIGLNESLLGIVAPFWLKD 178

  Fly   813 GYALWHGHQRVSSEVHSRLFLMGERLFATELLESNSFVDKI-------CKARNVNEMALAKAKQI 870
            .|....||:..     .|...:|......|.|:. ..||::       .|||:|    :||...|
  Rat   179 NYVNTIGHRAA-----ERALQLGTLFPPAEALKV-GLVDEVVPEDQVHSKARSV----MAKWFTI 233

  Fly   871 STSSAEMYRTLKKLNHSAVNVTK 893
            ...|.::.:::.: ..:|.|:.|
  Rat   234 PDHSRQLTKSMMR-KATADNLIK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HIPP1NP_649261.1 crotonase-like 673..870 CDD:119339 44/193 (23%)
Eci1NP_059002.2 ECH_1 39..285 CDD:278790 49/218 (22%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:P42126 93..97 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.