DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: u2af2b and Spf45

Sequence 1:XP_009292306.1 Gene:u2af2b ZFINID:ZDB-GENE-040426-1881 Length:480 Species:Danio rerio
Sequence 2:NP_001036426.1 Gene:Spf45 FlyBaseID:FBgn0086683 Length:403 Species:Drosophila melanogaster

Alignment Length:290 Identity:75/291 (26%)
Similarity:115/291 (40%) Gaps:81/291 (28%)


Zfish   224 AQSLKI----RRPHD---YQPLPGMSENPSVYVPAVQFQGVVSTVVPDSIHKLFIGG-------L 274
            |.:||:    .|.:|   |.|.||:          |..||..:...|.|:.::.|..       :
  Fly   150 APNLKLSGFGHRQNDDDMYLPSPGL----------VAKQGGATIAPPPSLQEMSIDSGCEATNTM 204

Zfish   275 PNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSK---GYAFCEYVDVNVNDQAIAGLNGMQLADK 336
            | |.......:::..:|       .|| ..||.|   |.|....|:.       ....|.::..:
  Fly   205 P-YSASSVAAKIMAKYG-------FKD-GQGLGKSEQGMAIALQVEK-------TSKRGGRIIHE 253

Zfish   337 K------LLVQRASVGAKNATMTSINETPVTLQVPGLTSNPMIQMGGI----------PTEVLCL 385
            |      |.:...|:|::..|..|....|     |....:...:.|.|          |::|:.|
  Fly   254 KDVFLPPLALSPPSIGSQIGTSPSHKAMP-----PPQMVDTAAESGDIGYSITEIMKSPSKVVLL 313

Zfish   386 MNMVAPEELIDDEEYEEIVEDVKEEC-SKYGQVKSIEIPR-----PVDGLDIPGTGKIFVEFTSV 444
            .|||.|.::  |||.|   .:||:|| :|||:|.|:.|..     |.|.:      ||||||..:
  Fly   314 RNMVGPGDV--DEELE---PEVKDECNTKYGEVNSVIIHESFGTVPEDAV------KIFVEFRRI 367

Zfish   445 YDSQKAMQGLTGRKFANRVVVTKYCDPDAY 474
            ..:.||:..|.||.|..|.|...:.:.|.:
  Fly   368 ESAIKAVVDLNGRFFGGRQVRAGFYNYDKF 397

Known Domains:


GeneSequenceDomainRegion External IDIdentity
u2af2bXP_009292306.1 RRM1_U2AF65 151..232 CDD:240676 4/12 (33%)
RRM2_U2AF65 267..343 CDD:240677 15/92 (16%)
RRM3_U2AF65 380..466 CDD:240678 36/92 (39%)
Spf45NP_001036426.1 G-patch 209..248 CDD:279867 10/54 (19%)
RRM_UHM_SPF45 307..402 CDD:241091 38/103 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.