DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Six4 and Six1

Sequence 1:NP_649256.1 Gene:Six4 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_446211.1 Gene:Six1 RGDID:620906 Length:284 Species:Rattus norvegicus

Alignment Length:192 Identity:113/193 (59%)
Similarity:141/193 (73%) Gaps:7/193 (4%)


  Fly   166 MSAVSSFPIDAKMLQFSTDQIQCMCEALQQKGDIEKLTTFLCSLPPSEFFKTNESVLRARAMVAY 230
            ||.:.||       .|:.:|:.|:||.|||.|::|:|..||.|||..:....|||||:|:|:||:
  Rat     1 MSMLPSF-------GFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAF 58

  Fly   231 NLGQFHELYNLLETHCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYPLPKTIWD 295
            :.|.|.|||.:||:|.||...|..||.||.||||.||||:||||||||.|||:|:|:|||:||||
  Rat    59 HRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWD 123

  Fly   296 GEETVYCFKEKSRNALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDRTPQQR 357
            ||||.||||||||..|::.|..|.||:|.||:.||:.||||.|||||||||||||||..:.:
  Rat   124 GEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAK 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483 63/109 (58%)
homeodomain 301..355 CDD:238039 37/54 (69%)
Six1NP_446211.1 SIX1_SD 9..118 CDD:339841 63/109 (58%)
homeodomain 129..180 CDD:238039 36/51 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.