DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13251 and ccdc66

Sequence 1:NP_649246.1 Gene:CG13251 FlyBaseID:FBgn0037014 Length:1088 Species:Drosophila melanogaster
Sequence 2:XP_021325331.1 Gene:ccdc66 ZFINID:ZDB-GENE-110317-1 Length:616 Species:Danio rerio

Alignment Length:713 Identity:150/714 (21%)
Similarity:252/714 (35%) Gaps:209/714 (29%)


  Fly     5 PEARQTHRLLDLKKQQWAKEREEIARMDEMYHHHHTSHHKIERTSIRTYYSNLDLSQTSTSNQTS 69
            |..::|.:|::.|......:|:|..|..:......::.:.:||..|......:|...:..:...|
Zfish    40 PPRKKTIQLINPKPGPCHPDRDEPGRKHKDAPAAGSTGNCMERPRIPNARRRMDTMSSEAARVQS 104

  Fly    70 SHSRRAPGPDMQLI--LRQPEYSQDNQGYMNQL-ERYIDDLDGDADADFEDEDESMYRRTRRGSY 131
            ...|....|..:.:  |.|.::.|    .::.: .|..::...:|....|:....     :.|:.
Zfish   105 EIDRSIVTPQNESVVCLTQEQFQQ----ILSSINSRSAENTHSEAVVSSEENCAG-----KTGAE 160

  Fly   132 AP----GMSSRQMQNPARYAELVPTSLQTAKGRMQ------NSRQEAQQHL---KHQHQQLLLQQ 183
            .|    |...:.     |.:|..|..|..:.|:..      ..|:..::.|   |.|.::.|.:|
Zfish   161 EPFVLEGCDYKH-----RASEEKPDKLILSDGQQSGLFSTFGEREREREKLEAKKAQWRRELDEQ 220

  Fly   184 QQHQQQQQQRLRSPSLP--AIRQRVRHQDSRTGKPTD-IDPGNGPHRLNNPPGGAGNPPGGGGGA 245
            ...::||:.|||..:.|  |...|::.....|...|: :.|...|......|....:....|..|
Zfish   221 MALKRQQKARLREKTAPNQACEVRLKDLSDSTAAATERLKPRAPPQMQRELPAAIRSAFIVGEAA 285

  Fly   246 PGPP---GCQEEDTSGYLSDTP--------KNPHTPDIWFNDGASQIESISGMGSASVLDGGSVG 299
            |...   ..:||....:|.:..        :..|...|     .||:|.|...  |:..|     
Zfish   286 PVEDMFNTQREEQQRRWLQELDQQIQEAKLRRKHDKQI-----NSQVEDIELW--AAHFD----- 338

  Fly   300 AVGGGVAGCRRLRRSIQAGTSGAPIPAPIPMPLPHHQPPPGNPLGKIYTIKGRRVPGQGYEPLAA 364
                          |:|...:.||.|......|.||.    :..|.:.|         .:|.::|
Zfish   339 --------------SLQQPLTVAPKPEVPDSSLSHHP----SVSGSLCT---------AWEGMSA 376

  Fly   365 DGYMADGYCYMPAPPSSSNMSMSRDVSTSNTYQVHIGNPDQNDFFVHEQHERERARWANFNGGAG 429
            .|  ||              |:.|                                         
Zfish   377 CG--AD--------------SLGR----------------------------------------- 384

  Fly   430 HQAAQQPPGWLSRGMHDLKDSEDDVQSMQSSSTYLRGQNAPLDAHTLAERMDKRRKAAEYHNAIK 494
                               .|.|..|..:..|:|||...|.||...:.||..:|.|..|:..||:
Zfish   385 -------------------ASVDTAQGNKQRSSYLRTMTALLDPAQIEERERRRLKQLEHQQAIE 430

  Fly   495 KQLHERELIRKWEHERHRQEEQIEEERIRRQKQLEQERL--EFERRTLQER--EEAQQKKQQVML 555
            .|:.||...::.|..|.|.:||.||.|:.|    |||||  ::.:.|.::|  ||.|.:|.:.:.
Zfish   431 AQVEERRRQKEKEEARRRAQEQEEERRVER----EQERLQQQYMKDTERQRHKEEVQTRKTEELY 491

  Fly   556 DAIQKAEVAAKMERQKRRMVRQPSKVSQETEEDESELIRVQSVEEEEDAEEKSGAVEPPSQ--EE 618
            .:||||:..|..|:|.:| :|..:|..    .|.|:|:  ||::         ||::..|.  |.
Zfish   492 LSIQKAQEEALKEKQVQR-IRDLAKKG----HDVSKLL--QSLD---------GALQEVSHQPEN 540

  Fly   619 ETSNTPRGA-----PPVMSEEKVLIGTPINLRRTITKPIKQPRDSRKE----------DPKEP 666
            |:...|.||     .|:.::..         |:|..:.:|...:|::.          ||.||
Zfish   541 ESIRDPAGAGMTDTAPLKAQHG---------RKTHHEELKVSDNSKEHTCSASKEAGADPYEP 594

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13251NP_649246.1 CCDC66 445..580 CDD:291889 49/139 (35%)
ccdc66XP_021325331.1 CCDC66 378..520 CDD:317619 56/227 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28UYI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.