DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13251 and ccdc66

Sequence 1:NP_649246.1 Gene:CG13251 FlyBaseID:FBgn0037014 Length:1088 Species:Drosophila melanogaster
Sequence 2:XP_004914234.1 Gene:ccdc66 XenbaseID:XB-GENE-6459434 Length:971 Species:Xenopus tropicalis

Alignment Length:1138 Identity:222/1139 (19%)
Similarity:367/1139 (32%) Gaps:400/1139 (35%)


  Fly    60 SQTSTSNQTSSHSRRAPGPDMQLILR--QPEYSQDNQGYMNQLERYIDDLDGDADADFEDEDESM 122
            ||...|.||::....|.|..::...|  ||..:|.|         .:.:|:....|....::..:
 Frog    48 SQVLKSVQTNNVKPEAAGQRIKSGSRDGQPSKAQVN---------VLKELENKHQAPVLQQNVQL 103

  Fly   123 YRRTRRGSYAPGMSSRQMQNPARYAELVPTSLQTAKGRMQNSRQEAQQHLKHQHQQLL-LQQQQH 186
            :::.      ||.:..|.:.|            |..|..:..|.:.:...:...:.|: |.|:|.
 Frog   104 HKQD------PGKAKAQPKRP------------THSGAPRQQRSQPKVSAEQLRESLVCLTQEQF 150

  Fly   187 QQ------------QQQQR----------------------LRSPSL------------------ 199
            ||            .|.||                      |.||.|                  
 Frog   151 QQILMTINQGNKIITQDQRESDAPEAGTEENTTEPARNENVLASPDLDPKAAEQSTDVYNTRLQG 215

  Fly   200 ---PAIRQRVRHQDSRTGKPT----DID-----------PGNGPHRLNNPPGGAGNPPGGGGGA- 245
               ..:.:|.|.:.....|.|    ::|           ...|..|.:...|.:.:.|||.... 
 Frog   216 DLFSTLGERERDKSLEEAKKTKWRKELDEQIATKKRLRESAQGGWRYSRHQGMSSSEPGGCDSVQ 280

  Fly   246 PGPPGCQEEDTSGYLSDTPKNPHTPDIWFNDGASQIESISGMGSASVLDGGSVGAVGGGVAGCRR 310
            |..|..|::.   |.||. ..|...|:.|....|...|.|   |..||.|.|    |.|      
 Frog   281 PSLPEAQKDP---YSSDR-GTPAQDDMLFGTSTSTETSDS---SPIVLSGPS----GRG------ 328

  Fly   311 LRRSIQAGTSGAPIPAPI--------PMPLPHHQPPPGNPLGKIYTIKGRRVPGQGYEPLAADGY 367
                  :..|...:||.|        ..|:.|       |...|    .|:...:..|.|.....
 Frog   329 ------SSFSSPELPAAIRSAFVLGEAAPMDH-------PFSAI----KRQQQKKWLEELNKQRE 376

  Fly   368 MA------------------------DGYCYMPAPPSSSNMSMSRDVSTSNTYQVHIGNPDQNDF 408
            .|                        |.:..:..|.:.:..:.:..:.|.|..      |.|.  
 Frog   377 EAVLRKKLEKKKMLEMEETEKWAMHFDSFKKISDPQTQAPYTPAELLQTQNLL------PAQR-- 433

  Fly   409 FVHEQHERERARWANFNGGAGHQAAQQP---PGWLS----RGMHDLKDSEDDVQSMQSSSTYLRG 466
                               ..|.|:.:|   |. ||    .|...|:.|:|:     ..:.:||.
 Frog   434 -------------------TAHSASAEPSVTPD-LSPTQCAGSELLRSSQDN-----QKTGFLRT 473

  Fly   467 QNAPLDAHTLAERMDKRRKAAEYHNAIKKQLHERELIRKWEHERHRQEEQIEEERIRRQKQLEQE 531
            ..|.||...:.||..||.|..|:..||..|:.|:...::.|.|:.::|||.||:::..::  ||.
 Frog   474 MTALLDPAQIEEREQKRLKQLEHQKAIAAQVEEKRRRKQLEEEQKQREEQEEEQKLAMER--EQM 536

  Fly   532 RLEFERRTLQER--EEAQQKKQQVMLDAIQKAEVAAKMERQKRRMVRQPSKVSQETEEDESELIR 594
            ..:||..|.::|  ||..:.|.:.:.:::|:|:..|:..:|::||        :..|....::.:
 Frog   537 HRQFEEDTKRQRQKEEMLKLKTKELYESMQRAQEEAQRLKQQQRM--------RHLEHKGHDIFQ 593

  Fly   595 VQSVEEE--EDAE---EKSGA-------VEPPSQEEETSN-------TPRGAPPVMSEE---KVL 637
            :|..::.  |.|:   .::|:       :.|||.....:.       :||....|.::|   .|.
 Frog   594 LQRNDDTHGEAAQLDASRAGSRSTDTTPLYPPSVANSAATHVPDVLVSPRKDTAVQTDEVDRGVT 658

  Fly   638 IGTPINLRRTITKPIKQPRDSRKEDPKEPTQTKVQ----------TTFLGEDKENVALLMQPATL 692
            :|..:        |.|.....|...|:.|.:.|.|          ::...|:||           
 Frog   659 VGAAL--------PAKDAVWGRSPSPEVPIEFKAQGRKPRSLRERSSSRKENKE----------- 704

  Fly   693 IPLPVTSDIFGLQNAIGNLQIATYFMQPP--MQKPPE--TPGS--YSKATMTHRTDTSIYTEDGY 751
              ||  .|.:. |.|....|......:|.  ..|||.  .|.|  |.|               |.
 Frog   705 --LP--HDYYE-QFARAERQAKEPAQKPDWNKNKPPRRFVPASERYPK---------------GL 749

  Fly   752 QAEKEEDPLTTARSGRTDLVTASGCFSPDSLEVDVAPVLIAETDKLALIPLKTPLQLGISNSSDD 816
            |.::||     :|..|                         :.:.:.|:....|     ||....
 Frog   750 QRQREE-----SRVRR-------------------------QHELMHLLEKNAP-----SNLQPK 779

  Fly   817 RGEHNHEVGHQADVETQTELPLNCDLCLFHDNFYKVLLKREVSTTTTTQT------SKSQTQPAK 875
            :|:           ..:..||.:       |...|:|.|:.|......:.      |.|...||.
 Frog   780 KGD-----------SPKKSLPGD-------DAKGKLLAKKAVPEEPVEKAEPYIKRSDSPPVPAV 826

  Fly   876 ESTAEKDHETTTTTTTTTT--------TTFKAKSKDKDKEKNLKRNLN----------KDKDANK 922
            ::...:.|:...:|.|...        .|:....:|...|.:.:.:..          :.|:...
 Frog   827 KNRMHQSHKRQNSTATNAVYNGGAIQGGTYTVSQRDVSPESSEQESERPPSSNFIPYVRTKEVYY 891

  Fly   923 MD-DRPKWGVNRPVVQYVKASDRDPFCLRKKKNHPSTAKPPRSL-SMDSRLD-----SVALPEDR 980
            :| |.|   ::||       |..||     :...|...:..|.: |.|...|     ||...:||
 Frog   892 LDPDAP---MSRP-------STHDP-----QYQRPGDEQTTRQIFSSDHARDPLLNPSVVKNKDR 941

  Fly   981 LINIAGGPPSAAGELEEEGFLLKARNVCTEILP 1013
            ...|..|    ..|| .:|.|.|.:.:.|.::|
 Frog   942 QQAILKG----LSEL-RKGLLQKQKELETGLMP 969

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13251NP_649246.1 CCDC66 445..580 CDD:291889 40/137 (29%)
ccdc66XP_004914234.1 CCDC66 451..591 CDD:291889 42/155 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C333951542
eggNOG 1 0.900 E1_28UYI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.