DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13251 and Ccdc66

Sequence 1:NP_649246.1 Gene:CG13251 FlyBaseID:FBgn0037014 Length:1088 Species:Drosophila melanogaster
Sequence 2:NP_796085.3 Gene:Ccdc66 MGIID:2443639 Length:935 Species:Mus musculus

Alignment Length:693 Identity:143/694 (21%)
Similarity:241/694 (35%) Gaps:190/694 (27%)


  Fly   412 EQHERERARWA-NFNGGAGHQAAQQ-------------------------------PPGWLSRGM 444
            |:|:    ||| :|:....|..:|.                               ||..:....
Mouse   355 EEHD----RWAVHFDSLKSHPGSQSRLSSQLTHQHLESLCVSPDTQELADVNGVFTPPPGVQAEP 415

  Fly   445 HDLKDSEDDVQSMQSS----STYLRGQNAPLDAHTLAERMDKRRKAAEYHNAIKKQLHERELIRK 505
            .:.:.....|..|..|    :.:||...|.||...:.||..:|:|..|:..||..|:.|....::
Mouse   416 SEKEQRARPVLEMAVSHGPKTNFLRSMTALLDPAQIEERERRRQKQLEHQKAIMAQVEENRRKKR 480

  Fly   506 WEHERHRQEEQIEEERIRRQKQLEQERLEFERRTLQEREEAQQKKQQVMLDAIQKAEVAAKMERQ 570
            .|.|:.::|||..|.|:.|:::..|.:.|.:....::|||....|...:...:|:|:..|:..:|
Mouse   481 LEEEQRKKEEQELELRLAREREEMQRQYEEDILKQRQREEIMTLKTNELFHTMQRAQELAQRLKQ 545

  Fly   571 KRRMVRQPSKVSQETEEDESELIRVQSVEEEEDAEEKSGAVEPPSQEEETSNTPRGAPP----VM 631
            ::| :|:.::...:|    |.||  |::..:.|.:..:......|..|||::|...:|.    |.
Mouse   546 EQR-IRELAQKGHDT----SRLI--QNLGAQVDYKAFTTISSSHSDPEETADTSTASPKKDTGVQ 603

  Fly   632 SEEKVLIGTPINLRRTITKPIKQPRDSRKEDP-KEPTQTKVQTTFLGED---KENVALLMQPATL 692
            :::       :||  .|......|..|..|.. :..:..::...|.|:.   |||..|.|...|.
Mouse   604 TDD-------VNL--GIFNDALPPCGSVTEKGIRNISSPEISAEFSGQTDIRKENQELSMNKGTN 659

  Fly   693 IPLPVTSDIFGLQNAIGNLQIATYFMQPP----MQKPPETPGSYSKATMTHRTDTSIYTEDGYQA 753
            :         ..:|:..|.|...|.....    |:|.|:.|.......:......|.......|.
Mouse   660 L---------DKENSWHNGQCNQYRRTEKQTKLMKKCPKKPAWNINKPLKKYVPASAKYPAHLQK 715

  Fly   754 EKEEDPLTTARSGRTDLVTASGCFSPDSLEVDVAPVLIAETDKLALIPLKTPLQLGISNSSDDRG 818
            ||||..:.                              .:.:.|.|:....|     .|.|.:||
Mouse   716 EKEEKKVQ------------------------------RQMELLHLVERNNP-----ENLSQNRG 745

  Fly   819 EHNHEVGHQADVETQTELPLNCDLCLFHDNFYKVLLKREVSTTTTTQTSKS--QTQPAKESTAEK 881
            .......|:   ||::|..|:             |:|:......|...||.  ||.||.::    
Mouse   746 ISPLATSHR---ETESESRLH-------------LIKKVEEPLKTPSVSKERFQTSPAVKN---- 790

  Fly   882 DHETTTTTTTTTTTTFKAKSKDKDKEKNLKRNLNKDKDANKMDDR-------------------- 926
                .|..|.:.......|:.|.:||     .|.......|:.|.                    
Mouse   791 ----RTQQTQSNVLHLPLKNNDYEKE-----TLTLGDGHTKLSDEMSEPSHFIPYVRTNEIYYLD 846

  Fly   927 PKWGVNRPVV---QYVKASDRDPFCLRKKKNHPSTAKPPRSLSMDSRLDSVALPE-----DRLIN 983
            |...::||..   ||.|:.|    |.|:::...|          |...|.:..|:     ||...
Mouse   847 PDAPLSRPSTQDNQYQKSHD----CAREQELFDS----------DHIRDPLLNPKLVKNRDRQQA 897

  Fly   984 IAGGPPSAAGELEEEGFLLKARNVCTEILPIKTDDKGRIFLNF 1026
            |..|    ..|| .:|.|.|.:.:.|.::|:..:.:.....:|
Mouse   898 ILKG----LSEL-RQGLLQKQKELETNLIPLTANQEDNFSSSF 935

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13251NP_649246.1 CCDC66 445..580 CDD:291889 37/139 (27%)
Ccdc66NP_796085.3 CCDC66 407..559 CDD:291889 39/153 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C333950872
eggNOG 1 0.900 E1_28UYI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR22736
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.