DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13251 and Ccdc66

Sequence 1:NP_649246.1 Gene:CG13251 FlyBaseID:FBgn0037014 Length:1088 Species:Drosophila melanogaster
Sequence 2:XP_008769251.1 Gene:Ccdc66 RGDID:1560873 Length:946 Species:Rattus norvegicus

Alignment Length:712 Identity:152/713 (21%)
Similarity:248/713 (35%) Gaps:221/713 (31%)


  Fly   412 EQHERERARWANFNGGAGHQ---AAQQPPGWL--------SRGMHD------------LKDSEDD 453
            |:|:|....:.:|....|.|   ::|..|..|        ::.:.|            :|.||.:
  Rat   359 EEHDRWAVHFDSFKSHPGSQSRLSSQLTPQHLESLCVSPDTQELADVSSVDTPPPAVQVKPSEKE 423

  Fly   454 -----VQSMQSS----STYLRGQNAPLDAHTLAERMDKRRKAAEYHNAIKKQLHERELIRKWEHE 509
                 |..|..|    :.:||...|.||...:.||..:|:|..|:..||..|:.|....::.|.|
  Rat   424 QRARPVMDMSVSHGQKTNFLRSMTALLDPAQIEERERRRQKQLEHQKAITAQVEENRRKKRLEEE 488

  Fly   510 RHRQEEQIEEERIRRQKQLEQERLEFERRTLQEREEAQQKKQQVMLDAIQKAEVAAKMERQKRRM 574
            :.|:|||.||.|:.|:::..|.:.|.:....:.:||....|...:...:|:|:..|:..:|::| 
  Rat   489 QRRKEEQEEELRLAREREEMQRQYEEDILKQKHKEEIMTLKTNELFHTMQRAQELAQRLKQEQR- 552

  Fly   575 VRQPSKVSQETEEDESELIRVQSVEEEEDAEEKSGAVEPPSQEEETSNTPRGAPPVMSEEKVLIG 639
            :|:.::...:|    |.||  |::....|. :.|..|......||.:|..|.|            
  Rat   553 IRELTQKGHDT----SRLI--QNLGAHVDC-KASTPVSSSRDTEEAANDTRAA------------ 598

  Fly   640 TPINLRRTITKPIKQPRDSRKEDPKEPTQTKVQTTFLGEDKENVALLMQPATLIPLPVTSDI--F 702
                  .|.|.       |.|:|      |.|||     |..|:.:...     .||....:  :
  Rat   599 ------ATSTA-------SPKKD------TGVQT-----DDVNLGIFND-----GLPHCGSVTEW 634

  Fly   703 GLQNAIGNLQIATYFMQPPMQKPPETPGSYSKATMTHRTDTSIYTEDGYQAEKE----------- 756
            |::|.                ..||....:|..|...:....:..:.|...:||           
  Rat   635 GVRNL----------------SSPEISAEFSGQTGIRKEKQELSMDKGTHLDKENSWYNNRCTQH 683

  Fly   757 --------------EDPLTTARSGRTDLVTASGCFSPDSLEVDVAPVLI-AETDKLALIPLKTPL 806
                          :.|...........|.||..: |..|:.:.....: .:.:.|.|:....|.
  Rat   684 RRTEKQTKLVKKCPKKPAWNINKPLKRYVPASAKY-PAHLQKEKEERKVRRQMELLHLVQRNDPE 747

  Fly   807 QLGISN-SSDDRGEHNHEVGHQADVETQTELPLNCDLCLFHDNFYKVLLKR--------EVSTTT 862
            .|..:| :|.|....:|.       |.::|:.|:             |||:        .||.|.
  Rat   748 TLSQNNGASPDIFVSSHR-------EAESEMRLH-------------LLKKVKLLYFSPAVSETV 792

  Fly   863 --TTQTSKSQTQ---------PAKESTAEKDHETTTTTTTTTTTTFKAKSKDKDKEKNLKRNLNK 916
              |:...||:||         |.|.|..||:        |.|......|..|:..|.:......:
  Rat   793 FQTSPAVKSRTQQTQSNILHLPPKNSDYEKE--------TLTLGDGHTKLSDERSEPSHFIPYVR 849

  Fly   917 DKDANKMD-DRPKWGVNRPVV---QYVKASD-------------RDPFCLRKKKNHPSTAKPPRS 964
            ..:...:| |.|   ::||..   ||.|:.|             |||..      :|...|    
  Rat   850 TNEIYYLDPDAP---LSRPSTQDNQYQKSHDCGGGQELFDSDHIRDPLL------NPKLVK---- 901

  Fly   965 LSMDSRLDSVALPEDRLINIAGGPPSAAGELEEEGFLLKARNVCTEILPIKTDDKGRIFLNF 1026
                ||        ||...|..|    ..|| .:|.|.|.:.:.|.::|:..:.:.....:|
  Rat   902 ----SR--------DRQQAILRG----LSEL-RQGLLQKQKELETNLIPLTANQEDNFSSSF 946

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13251NP_649246.1 CCDC66 445..580 CDD:291889 42/156 (27%)
Ccdc66XP_008769251.1 CCDC66 409..563 CDD:291889 41/155 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C333951332
eggNOG 1 0.900 E1_28UYI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR22736
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.