DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13251 and CCDC66

Sequence 1:NP_649246.1 Gene:CG13251 FlyBaseID:FBgn0037014 Length:1088 Species:Drosophila melanogaster
Sequence 2:NP_001340076.1 Gene:CCDC66 HGNCID:27709 Length:954 Species:Homo sapiens

Alignment Length:642 Identity:131/643 (20%)
Similarity:234/643 (36%) Gaps:194/643 (30%)


  Fly   445 HDLKDSEDDVQSMQSSSTYLRGQNAPLDAHTLAERMDKRRKAAEYHNAIKKQLHERELIRKWEHE 509
            |..|..:|.|.:....:.:||...|.||...:.||..:|:|..|:..||..|:.|:...::.|.|
Human   423 HIAKPIKDVVMANSKKTNFLRSMTALLDPAQIEERDRRRQKQLEHQKAITAQVEEKRRKKQLEEE 487

  Fly   510 RHRQEEQIEEERIRRQKQLEQERLEFERRTLQEREEAQQKKQQVMLDAIQKAEVAAKMERQKRRM 574
            :.::|||.||.|:.::::..|::.|.:....:::||....|...:...:|:|:..|:..:|::| 
Human   488 QRKKEEQEEELRLAQEREEMQKQYEEDILKQKQKEEIMTLKTNELFQTMQRAQELAQRLKQEQR- 551

  Fly   575 VRQPSKVSQETEEDESELIR---------VQSVEEE----------EDAEEKSGAVEPPSQEEET 620
            :|:.::...:|    |.||:         |.:::.|          .|::|.||.:. ......|
Human   552 IRELAQKGHDT----SRLIKNLGGDFSLPVDTIQMEYNASNISNSRHDSDEISGKMN-TYMNSTT 611

  Fly   621 SNTPRGAPPVMSEEKVLIGTPIN--------LRRTITKPIKQP--------RDSRKEDPKEPTQT 669
            |....|    :..:.:.||...|        :.|.||. ...|        :.|.|::.:|.||.
Human   612 SKKDTG----VQTDDLNIGIFTNAESHCGSLMERDITN-CSSPEISAELIGQFSTKKNKQELTQD 671

  Fly   670 KVQTTFLGEDKENVALLMQPATLIPLPVTSDIFGLQNAIGNLQIATYFMQP-------PMQKPPE 727
            |..:.    :|||.....|                .|....::..|..|:.       .:.|||:
Human   672 KGASL----EKENNRCNDQ----------------CNQFTRIEKQTKHMKKYPKRPDWNINKPPK 716

  Fly   728 --TPGS--YSKATMTHRTDTSIYTEDGYQAEKEEDPLTTARSGRTDLVTASGCFSPDSLEVDVAP 788
              .|.|  |.|                 |.:|:.:.....|                        
Human   717 RYIPASEKYPK-----------------QLQKQREEKKVRR------------------------ 740

  Fly   789 VLIAETDKLALIPLKTPLQLGISNSSDDRGEHNHEVGHQADVETQTEL----------PLNCDLC 843
                :.:.|.|:....|..|     |.:|| .:.|:.|.:..||:::|          |||    
Human   741 ----QMELLHLVEKNNPGHL-----SQNRG-ISPEIFHSSHQETESKLRWHLVKKEEEPLN---- 791

  Fly   844 LFHDNFYKVLLKREVSTTTTTQTSKSQTQ--------PAKESTAEKDHETTTTTTTTTTTTFKAK 900
             .|.      ..:|.|.::.....|::||        |.|.|:.|:::..:.:..|..::..   
Human   792 -IHS------FSKERSPSSPVPVVKNRTQQTQNTLHLPLKNSSYERENLISGSNQTELSSGI--- 846

  Fly   901 SKDKDKEKNLKRNLNKDKDANKMD-DRPKWGVNRPVVQYVKASD-------RDPFCLRKKKNHPS 957
            |:.......::.|     :...:| |.|..|.:....||..:.|       .|..|:|....:|:
Human   847 SESSHFIPYVRTN-----EIYYLDPDAPLSGPSTQDPQYQNSQDCGQKRQLFDSDCVRDPLLNPN 906

  Fly   958 TAKPPRSLSMDSRLDSVALPEDRLINIAGGPPSAAGELEEEGFLLKARNVCTEILPI 1014
            ..|                ..||...|..|    ..|| .:|.|.|.:.:.:.:||:
Human   907 MVK----------------NRDRQQAILKG----LSEL-RQGLLQKQKELESSLLPL 942

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13251NP_649246.1 CCDC66 445..580 CDD:291889 37/135 (27%)
CCDC66NP_001340076.1 CCDC66 411..562 CDD:317619 37/140 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C333947892
eggNOG 1 0.900 E1_28UYI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR22736
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.