DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13250 and CG33640

DIOPT Version :8

Sequence 1:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster

Alignment Length:166 Identity:34/167 (20%)
Similarity:75/167 (45%) Gaps:15/167 (9%)


  Fly    38 INCSV------IDPTTAEIFKCDIV----EMPKKQGN--FLNTFLLLRRSVTKMWVELSVGQIAN 90
            ||||:      :|..|..:...|:.    .:.::.||  :|:..:::.|.|..:.:..|:.  ..
  Fly    15 INCSLCAHVVFVDHFTFTVDDRDLFLSQSAVVEQDGNRSYLSGHMMINRLVNDLTLTSSMD--IT 77

  Fly    91 RKDRPVQQLFKIRVDGCHLIEFRSKSRILNAVLHKLLQSGNYPDACPLLANVNYTSTRFALNPDH 155
            |..||..:|:.::::.|.::....|::.:..:.:...|..|....|||..|.||:..|..::...
  Fly    78 RPQRPELRLYNVQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPKCPLKPNFNYSLHRAYIDEAM 142

  Fly   156 FPAYMPDMKFNTKLVFQLSRNMGLIRASVDAEVMRR 191
            .|..:|:..:..|:.|:....: |....:|..::.:
  Fly   143 LPDLLPECTYRLKMSFKHKSKL-LAHMQIDGRLLSK 177

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13250NP_649245.1 DM8 95..181 CDD:214778 18/86 (21%)
CG33640NP_001027255.2 DUF1091 73..154 CDD:284008 18/83 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2FA0X
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.