DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13250 and CG33914

DIOPT Version :8

Sequence 1:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster

Alignment Length:147 Identity:23/148 (16%)
Similarity:55/148 (37%) Gaps:26/148 (18%)


  Fly    11 LILCCLVVPILWQPSLATRDFDIRWRDINCSVIDPTTAEIFKCDIVEMPKKQGNFLNTFLLLRRS 75
            |:||.|.:..|       ....:|:.::.|...|.:.:.:..|.:..:.|.:.:....:.:|:..
  Fly    11 LLLCLLFLTEL-------HGVFMRFTNVTCESKDLSMSIVEYCAVTTLSKNKNSISLRYAMLKPM 68

  Fly    76 VTKMWVELSVGQIANRKDRPVQQ-------LFKIRVDGCHLIEFRSKSRILNAVLHKLLQS-GNY 132
            .|.:.:..   |:..|....:..       |..:::|.|..  :::....|..::.:.:.. .|.
  Fly    69 FTNIEIYF---QLMTRGSESIHAASNWQPFLHTMKLDLCRF--WKNHHNHLARMVFEFIDGHTNM 128

  Fly   133 PDACPLLANVNYTSTRF 149
            ...||      ||..::
  Fly   129 NHTCP------YTKEKY 139

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13250NP_649245.1 DM8 95..181 CDD:214778 9/64 (14%)
CG33914NP_001027394.2 DUF1091 85..166 CDD:284008 9/64 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C301040
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.