DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13250 and CG33770

DIOPT Version :10

Sequence 1:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster


Alignment Length:108 Identity:28/108 - (25%)
Similarity:46/108 - (42%) Gaps:22/108 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 FLNTFLLLRRSVTKMW-VELSV-GQIANRKDRPVQQLFKIRVDGCHLIEFRSKSRILNAVLHKLL 127
            ||:.:  ||:.:.:.| ..|.. .::.|.|.  .|.||...:|.|:::. .:|..:.......||
  Fly    59 FLDMY--LRKPLVRGWRARLDFRTRVGNSKS--FQSLFSTSIDVCNIVN-AAKINLFKKWYKNLL 118

  Fly   128 QSGNYPDACPLLANVNYTSTRFALNPDHFPAYMPDMKFNTKLV 170
            :.||:...||             ||..|:  |:.|.:|...||
  Fly   119 KYGNFLRQCP-------------LNASHY--YLRDWQFGEGLV 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13250NP_649245.1 DM8 95..181 CDD:214778 20/76 (26%)
CG33770NP_001027144.2 DM8 88..178 CDD:214778 20/75 (27%)

Return to query results.
Submit another query.