DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13250 and CG33770

DIOPT Version :8

Sequence 1:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster

Alignment Length:108 Identity:28/109 (26%)
Similarity:46/109 (42%) Gaps:22/109 (20%)


  Fly    65 FLNTFLLLRRSVTKMW-VELSV-GQIANRKDRPVQQLFKIRVDGCHLIEFRSKSRILNAVLHKLL 127
            ||:.:  ||:.:.:.| ..|.. .::.|.|.  .|.||...:|.|:::. .:|..:.......||
  Fly    59 FLDMY--LRKPLVRGWRARLDFRTRVGNSKS--FQSLFSTSIDVCNIVN-AAKINLFKKWYKNLL 118

  Fly   128 QSGNYPDACPLLANVNYTSTRFALNPDHFPAYMPDMKFNTKLV 170
            :.||:...||             ||..|:  |:.|.:|...||
  Fly   119 KYGNFLRQCP-------------LNASHY--YLRDWQFGEGLV 146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13250NP_649245.1 DM8 95..181 CDD:214778 20/77 (26%)
CG33770NP_001027144.2 DM8 88..178 CDD:214778 20/76 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49656
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.