powered by:
                   
 
    
    
             
          
            Protein Alignment CG13250 and CG33703
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_649245.1 | Gene: | CG13250 / 40284 | FlyBaseID: | FBgn0037013 | Length: | 192 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_001027119.1 | Gene: | CG33703 / 3771760 | FlyBaseID: | FBgn0053703 | Length: | 181 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 136 | Identity: | 33/136 - (24%) | 
          
            | Similarity: | 58/136 -  (42%) | Gaps: | 11/136 - (8%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly    13 LCCLVVPILWQPSLAT-RDFDIRWRDINCSVIDPTTAEIFKCDIVEMPKKQGN---FLNTFLLLR 73|..||:|:|.....:. |.|  |...:.|..:||:......|.:|.  ::.|.   :::...|.:
 Fly     5 LLSLVLPLLIILDCSQGRVF--RVSKMECRSLDPSFTYFKTCKVVR--RENGRAALYVSEVFLYK 65
 
 
  Fly    74 RSVTKMWVELSVGQIANRKDRPVQQLFKIRVDGCHLIEFRSKSRILNAVLHKLLQSGNYPDACPL 138..:..:.:.|.|.:||  |:|..|.|.: .:|.|........|.....::..||:..|....|||
 Fly    66 DPIDDIVLNLGVFRIA--KNRRFQFLNE-TLDYCLFSRQYLASGFFGFLMTPLLRISNLNATCPL 127
 
 
  Fly   139 LANVNY 144..|:.:
 Fly   128 QQNITF 133
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
          
          
            | Gene | Sequence | Domain | Region | External ID | Identity | 
          
            | CG13250 | NP_649245.1 | DM8 | 95..181 | CDD:214778 | 12/50 (24%) | 
          
            | CG33703 | NP_001027119.1 | DUF1091 | 73..155 | CDD:284008 | 18/64 (28%) | 
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | P | PTHR20898 | 
          
            | Phylome | 0 | 0.000 | Not matched by this tool. | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 1 | 1.100 |  | 
        
      
           
             Return to query results.
             Submit another query.