DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13250 and CG33703

DIOPT Version :9

Sequence 1:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001027119.1 Gene:CG33703 / 3771760 FlyBaseID:FBgn0053703 Length:181 Species:Drosophila melanogaster


Alignment Length:136 Identity:33/136 - (24%)
Similarity:58/136 - (42%) Gaps:11/136 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LCCLVVPILWQPSLAT-RDFDIRWRDINCSVIDPTTAEIFKCDIVEMPKKQGN---FLNTFLLLR 73
            |..||:|:|.....:. |.|  |...:.|..:||:......|.:|.  ::.|.   :::...|.:
  Fly     5 LLSLVLPLLIILDCSQGRVF--RVSKMECRSLDPSFTYFKTCKVVR--RENGRAALYVSEVFLYK 65

  Fly    74 RSVTKMWVELSVGQIANRKDRPVQQLFKIRVDGCHLIEFRSKSRILNAVLHKLLQSGNYPDACPL 138
            ..:..:.:.|.|.:||  |:|..|.|.: .:|.|........|.....::..||:..|....|||
  Fly    66 DPIDDIVLNLGVFRIA--KNRRFQFLNE-TLDYCLFSRQYLASGFFGFLMTPLLRISNLNATCPL 127

  Fly   139 LANVNY 144
            ..|:.:
  Fly   128 QQNITF 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13250NP_649245.1 DM8 95..181 CDD:214778 12/50 (24%)
CG33703NP_001027119.1 DUF1091 73..155 CDD:284008 18/64 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.