DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13250 and CG33137

DIOPT Version :9

Sequence 1:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster


Alignment Length:155 Identity:29/155 - (18%)
Similarity:55/155 - (35%) Gaps:43/155 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RDINCSVIDPTTAEIFKCDI-------------VEMPKKQGNFLNTFLLLRRSVTKMWVELSVGQ 87
            ::|.||.:...:|.. .|.|             |.:.:...|....|.:|::..:..:....|..
  Fly    17 KNIECSTVPGFSANA-SCHIRAINWNKAVAEMDVYLLRPLYNITIRFQILKKDYSNKFQPFLVDV 80

  Fly    88 IANRKDRPVQQLFKIRVDGCHLIEFRSKSRILNAVLHKLLQS-GNYPDACP----LLANVNYTST 147
            :.|..|...::.|         |.:       ..::.|:.:: .|:..:||    |:|...|   
  Fly    81 VINMCDALSRRSF---------IPY-------GLIILKIARTFSNFNHSCPYRGHLMARGAY--- 126

  Fly   148 RFALNPDHFPAYMP--DMKFNTKLV 170
               ||..:.|...|  ..|||..::
  Fly   127 ---LNESYLPNVFPLGFYKFNITIM 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13250NP_649245.1 DM8 95..181 CDD:214778 16/83 (19%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 19/98 (19%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - -
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.