DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13250 and CG33137

DIOPT Version :9

Sequence 1:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster


Alignment Length:155 Identity:29/155 - (18%)
Similarity:55/155 - (35%) Gaps:43/155 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RDINCSVIDPTTAEIFKCDI-------------VEMPKKQGNFLNTFLLLRRSVTKMWVELSVGQ 87
            ::|.||.:...:|.. .|.|             |.:.:...|....|.:|::..:..:....|..
  Fly    17 KNIECSTVPGFSANA-SCHIRAINWNKAVAEMDVYLLRPLYNITIRFQILKKDYSNKFQPFLVDV 80

  Fly    88 IANRKDRPVQQLFKIRVDGCHLIEFRSKSRILNAVLHKLLQS-GNYPDACP----LLANVNYTST 147
            :.|..|...::.|         |.:       ..::.|:.:: .|:..:||    |:|...|   
  Fly    81 VINMCDALSRRSF---------IPY-------GLIILKIARTFSNFNHSCPYRGHLMARGAY--- 126

  Fly   148 RFALNPDHFPAYMP--DMKFNTKLV 170
               ||..:.|...|  ..|||..::
  Fly   127 ---LNESYLPNVFPLGFYKFNITIM 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13250NP_649245.1 DM8 95..181 CDD:214778 16/83 (19%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 19/98 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472645
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.